Anticorps primaires

Affinity purified Rabbit polyclonal Perforin 1 antibody

FGF21 antibody is a monoclonal antibody that belongs to the class of antibodies used in Life Sciences. It specifically targets and inhibits the activity of vascular endothelial growth factor (VEGF), a growth factor involved in angiogenesis. This antibody has been shown to be effective in blocking the activation of VEGF, thereby preventing the formation of new blood vessels. FGF21 antibody also exhibits anticoagulant properties by inhibiting platelet aggregation, making it useful for conditions such as heparin-induced thrombocytopenia. Additionally, this antibody has natriuretic effects and can regulate fluid balance in the body. With its antiangiogenic properties, FGF21 antibody holds great potential for therapeutic applications in various diseases related to abnormal blood vessel growth.

entB Monoclonal Antibody Biotin

GCLM antibody was raised using the middle region of GCLM corresponding to a region with amino acids KPNSNQVNLASCCVMPPDLTAFAKQFDIQLLTHNDPKELLSEASFQEALQ

The MHC class II antibody is a powerful tool in the field of Life Sciences. This monoclonal antibody specifically targets the antigen binding domain of MHC class II molecules, which play a crucial role in immune response regulation. By binding to these molecules, the antibody can modulate their activity and impact various biological processes.

The CCR5 antibody is a monoclonal antibody that has been widely used in Life Sciences research. It targets the CCR5 receptor, a glycoprotein found on the surface of immune cells. This antibody has been shown to have neutralizing effects on CCR5, blocking its interaction with the ligands and inhibiting viral entry into host cells. It has been used in various immunoassays and hybridoma cell studies to investigate the role of CCR5 in immune response and disease progression. Additionally, this antibody has been utilized for its potential antiviral properties, particularly against HIV-1 strains that use CCR5 as a co-receptor for viral entry. Its specificity and high affinity make it a valuable tool for studying CCR5-related signaling pathways and developing therapeutic strategies targeting this receptor.

Rabbit anti-rat IgG (H+L) (HRP) was raised in rabbit using rat IgG whole molecule as the immunogen.

The VPAC2 antibody is a glycoprotein that acts as an endonuclease. It specifically targets and binds to the VPAC2 receptor, which is involved in various biological processes such as cell growth, differentiation, and immune response. This antibody is commonly used in life sciences research and has applications in fields such as immunology, cancer research, and drug development.

Mouse monoclonal NGAL antibody (Biotin)

Mouse monoclonal UNG antibody

Rabbit polyclonal SFN antibody

Rabbit polyclonal OR52A4 antibody

Rabbit polyclonal PIN1 antibody (Ser16)

NAT9 antibody was raised using a synthetic peptide corresponding to a region with amino acids MRLNQNTLLLGKKVVLVPYTSEHVPSRYHEWMKSEELQRLTASEPLTLEQ

Rabbit polyclonal TRAP1 antibody

Rabbit polyclonal Chicken Serum Albumin antibody

Rat monoclonal CD71 antibody (allophycocyanin)

DHRS4 antibody was raised in Rabbit using Human DHRS4 as the immunogen

The CD68 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It is specifically designed to target and bind to CD68, a glycoprotein that is expressed on the surface of activated macrophages, adipose tissue cells, and certain types of collagen. This antibody is widely used in research and diagnostic applications to detect the presence of CD68 in various biological samples, such as human serum or tissues.

COPS8 antibody was raised in Rabbit using Human COPS8 as the immunogen

Affinity purified Rabbit polyclonal ZC3H8 antibody

The SCF antibody is a polyclonal antibody that has the ability to neutralize the activity of stem cell factor (SCF). Stem cell factor is an important growth factor involved in various cellular processes, including cell proliferation, differentiation, and survival. The SCF antibody can specifically bind to SCF and inhibit its function, preventing it from interacting with its receptor and initiating downstream signaling pathways.

Affinity purified Rabbit polyclonal PANK1 antibody

ACADM antibody was raised using the N terminal of ACADM corresponding to a region with amino acids ATARKFAREEIIPVAAEYDKTGEYPVPLIRRAWELGLMNTHIPENCGGLG

Rabbit polyclonal SLC11A2 antibody

Rat monoclonal MHC Class II antibody (biotin)

CD4 antibody was raised in mouse using CD4+ transfectant/CEM as the immunogen.

The GST antibody is a cholinergic monoclonal antibody used in Life Sciences research. It specifically targets and binds to the glutathione S-transferase (GST) protein, which is involved in various cellular processes. This antibody is commonly used in studies related to alpha-fetoprotein, cryptosporidium, adeno-associated virus, activated epidermal growth factor, β-catenin, steroid acetyltransferase, and electrode research. The GST antibody has been extensively tested and validated for its specificity and sensitivity in detecting GST protein in various samples, including human serum. Researchers rely on this antibody to accurately analyze the expression and localization of GST protein in their experiments. Its high-quality performance makes it an essential tool for studying the functions and interactions of GST in different biological systems.

Rabbit polyclonal TBX2 antibody

CD3G antibody was raised in Rabbit using Human CD3G as the immunogen

Mouse monoclonal JEV ED3 antibody

The Smoothelin antibody is a highly specific antibody that targets smoothelin, a protein found in smooth muscle cells. It has been extensively tested and validated for use in various applications, including immunohistochemistry, western blotting, and flow cytometry. This antibody is produced using state-of-the-art techniques, ensuring high affinity and specificity. It can be used to study the role of smoothelin in various physiological and pathological processes, such as smooth muscle contraction, cardiovascular diseases, and cancer. The Smoothelin antibody is an essential tool for researchers in the field of life sciences who are interested in understanding the function of smooth muscle cells and developing potential therapeutic interventions.

TNFRSF18 antibody was raised in rabbit using the C terminal of TNFRSF18 as the immunogen

CD86 antibody (Spectral Red) was raised in rat using murine CD86 as the immunoge.

CNGA3 antibody was raised in Rabbit using Human CNGA3 as the immunogen

The NLK antibody is a powerful tool in the field of Life Sciences. This polyclonal antibody has neutralizing properties and is able to bind to various growth factors, including fibrinogen, collagen, and fibronectin. It has been extensively tested in human serum and has shown high affinity for alpha-fetoprotein and anti-mesothelin antibodies. The NLK antibody can be used in a variety of applications, such as immunohistochemistry, Western blotting, and ELISA assays. With its exceptional binding capacity and specificity, this antibody is an invaluable resource for researchers in the field. Whether you're studying cell signaling pathways or investigating protein-protein interactions, the NLK antibody will provide reliable results and contribute to the advancement of scientific knowledge.

GADD45GIP1 antibody was raised in Rabbit using Human GADD45GIP1 as the immunogen

The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug belonging to the rifamycins class. It is specifically designed to combat tuberculosis infections by targeting active compounds and exhibiting bactericidal activity. Through its unique mechanism of action, this drug inhibits bacterial growth by binding to DNA-dependent RNA polymerase, preventing transcription and replication. Extensive research has demonstrated its high efficacy using advanced techniques like the patch-clamp technique on human erythrocytes. Metabolized through various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid, this drug offers a comprehensive approach to tackling Mycobacterium tuberculosis strains. Experience the exceptional potency of 6-Fluoro-3-indoxyl-beta-D-galactopyranoside in combating tuberculosis

Affinity purified Rabbit polyclonal PRPSAP2 antibody

The LXN antibody is a monoclonal antibody that is used to detect and study angiogenic factors. It can be used in various research applications, including immunohistochemistry and Western blotting. The LXN antibody specifically recognizes and binds to a target protein, allowing for the detection and analysis of its expression levels. This antibody has been shown to inhibit syncytia formation and block the activity of certain growth factors. Additionally, it has been found to have cholinergic activity and can modulate the function of nucleotide molecules. The LXN antibody is available as a ready-to-use solution and can be easily incorporated into experimental protocols.

The TNFSF9 antibody is a highly specialized product used in the field of Life Sciences. This monoclonal antibody is designed to target and neutralize TNFSF9, a growth factor involved in various biological processes. The antibody has been extensively modified to enhance its efficacy and specificity, including acid modifications and glycosylation.

The CFOS antibody is a highly specialized antibody that has antiangiogenic properties. It is commonly used in Life Sciences research to study the formation of new blood vessels and their role in various biological processes. The CFOS antibody works by inhibiting the pro-angiogenic activity of certain proteins, such as epidermal growth factor, that are involved in promoting blood vessel growth. This monoclonal antibody binds specifically to CFOS, a basic protein that plays a key role in regulating cell growth and differentiation. By targeting CFOS, the CFOS antibody can effectively block the formation of new blood vessels and inhibit tumor growth. It is available as both a polyclonal and monoclonal antibody, providing researchers with options for their specific experimental needs. With its high specificity and cytotoxic effects on endothelial cells, the CFOS antibody has proven to be a valuable tool in studying angiogenesis and developing potential anti-cancer therapies.

Sheep polyclonal Androstanedione antibody

Rabbit polyclonal p44 MAPK antibody

The Androgen Receptor antibody is a neutralizing monoclonal antibody that targets the androgen receptor, a protein involved in the regulation of male sexual development and function. This antibody has been shown to inhibit the activity of the androgen receptor, leading to decreased growth factor signaling and reduced expression of genes regulated by androgens.

Mouse monoclonal MTMR14 antibody

The MCM5 antibody is a polyclonal antibody that is used for immobilization in various assays. It can be used to detect the presence of MCM5 protein in human serum or other samples. This antibody can be immobilized on an electrode surface, allowing for the detection and quantification of MCM5 protein levels. The MCM5 antibody recognizes specific hormone peptides and fatty acids that are associated with the activation of MCM5. It can also be used as a tool to study the interaction between MCM5 and other molecules, such as tyrosine inhibitors or monoclonal antibodies. Molecular docking studies have shown that this antibody has a high affinity for activated MCM5, making it an effective tool for research purposes. Additionally, colloidal gold-labeled versions of this antibody can be used for immunohistochemical staining to visualize the expression of MCM5 in tissue samples.

Rabbit polyclonal BDNF antibody (HRP)

DBNL antibody was raised in Rabbit using Human DBNL as the immunogen

The CCR10 antibody is a monoclonal antibody that specifically targets CCR10, a chemokine receptor involved in immune responses. This antibody can be used for various applications in the field of Life Sciences, including research and diagnostics. It has been shown to effectively neutralize the activity of CCR10 by binding to its natural ligand and preventing its interaction with other molecules. The CCR10 antibody can be used in hybridization experiments to detect the presence of CCR10 mRNA or protein in different tissues or cell types. Additionally, it can be used in immunohistochemistry or flow cytometry assays to study the expression pattern of CCR10 in various biological samples. This antibody is highly specific and exhibits low cross-reactivity with other related receptors. It is available as both monoclonal and polyclonal antibodies, providing researchers with options based on their specific experimental needs. The CCR10 antibody is a valuable tool for studying immune responses, inflammation, and adipose tissue biology.

CD25 antibody (biotin) was raised in rat using IL-2-dependent BALB/c mouse helper T-cell clone HT-2 as the immunogen.

Rabbit polyclonal PSMB2 antibody (FITC)

GABRB2 antibody was raised using a synthetic peptide corresponding to a region with amino acids MWRVRKRGYFGIWSFPLIIAAVCAQSVNDPSNMSLVKETVDRLLKGYDIR

Rabbit polyclonal IP3R1 antibody (Ser1764)

The HSF2 antibody is a polyclonal antibody that is derived from human serum. It is used in various applications such as electrode coating, immunohistochemistry, and western blotting. This antibody specifically targets histidine-rich proteins and autoantibodies present in the sample. The HSF2 antibody can be used in combination with other antibodies, such as monoclonal antibodies, to enhance its specificity and sensitivity. It is commonly used in life sciences research to study the role of histidine-rich proteins in various biological processes, including dopamine and insulin signaling, growth factor signaling (such as epidermal growth factor), and neutralizing effects on specific antigens. The HSF2 antibody is formulated with excipients to ensure stability and long shelf life.

FARS2 antibody was raised in Rabbit using Human FARS2 as the immunogen

FGD2 antibody was raised in Rabbit using Human FGD2 as the immunogen

The P38 MAPK antibody is a highly specialized tool used in Life Sciences research. It is an electrode-based antibody that specifically targets and binds to the p38 mitogen-activated protein kinase (MAPK) antigen. This antibody is widely used in various research assays to study the role of p38 MAPK in cellular processes such as glucose-6-phosphate metabolism, inflammation, and cell signaling.

Affinity purified Rabbit polyclonal SENP2 antibody

The EpCAM antibody is a monoclonal antibody that specifically targets the Epithelial Cell Adhesion Molecule (EpCAM). It has been widely used in Life Sciences research for various applications. This neutralizing antibody can effectively block the interaction between EpCAM and its ligands, preventing downstream signaling events.

MGC42174 antibody was raised using the N terminal Of Mgc42174 corresponding to a region with amino acids MSHPDYRMNLRPLGTPRGVSAVAGPHDIGASPGDKKSKNRSTRGKKKSIF

Affinity purified Rabbit polyclonal FAM122B antibody

The PDPN antibody is a monoclonal antibody used in the field of Life Sciences. It is commonly known as an antiphospholipid antibody and has been extensively studied for its role in various biological processes. This antibody specifically targets podoplanin, a glycoprotein expressed on the surface of many cell types.

Human kappa light chain antibody was raised in mouse using a constantly expressed epitope of kappa chain as the immunogen.

TAZ antibody was raised in rabbit using residures 386-400 [VESALNKSEPFLTWL] of the 49kDa human TAZ protein as the immunogen.

GPR37 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.

The SEMA4A antibody is a polyclonal antibody that specifically targets the protein SEMA4A, which belongs to the family of costimulatory molecules. This antibody can be used in various life sciences applications, including immunomodulatory research and dendritic cell studies. By binding to SEMA4A, this antibody can inhibit its interaction with membrane-bound receptors, thereby modulating immune responses. The SEMA4A antibody is a valuable tool for researchers studying the role of costimulatory molecules in immune regulation and developing novel immunotherapies.

C1R antibody is a polyclonal antibody that targets the C1R protein complex. It has neutralizing properties and can be used in various life science applications. This antibody has been shown to inhibit the activity of interferon, TNF-α, and interleukin-6. It can be used in research studies to investigate the role of C1R in different biological processes. The C1R antibody is highly specific and reliable, making it an essential tool for researchers working with biomolecules. Whether you are studying dopamine signaling or exploring the effects of haloperidol and droperidol, this antibody will provide accurate and reproducible results.

SYCP1 antibody was raised using the N terminal of SYCP1 corresponding to a region with amino acids NFLPVLEQVGNSDCHYQEGLKDSDLENSEGLSRVYSKLYKEAEKIKKWKV

Rabbit polyclonal SNAPIN antibody

IL27 antibody was raised in rabbit using the C terminal of IL27 as the immunogen

NR5A1 antibody was raised using the middle region of NR5A1 corresponding to a region with amino acids SLHGPEPKGLAAGPPAGPLGDFGAPALPMAVPGAHGPLAGYLYPAFPGRA

alpha 1 Antiplasmin antibody was raised in sheep using human alpha 1 Antiplasmin purified from plasma as the immunogen.

The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections and contains active compounds with bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, which inhibits bacterial growth and prevents transcription and replication. Additionally, it has been extensively studied using the patch-clamp technique on human erythrocytes, demonstrating its high frequency of human activity. The active form of this drug undergoes various metabolic transformations such as hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. It also specifically binds to markers expressed in Mycobacterium tuberculosis strains and inhibits cell growth in culture.

RRP1B antibody was raised using a synthetic peptide corresponding to a region with amino acids VTFGLNRNMTAEFKKTDKSILVSPTGPSRVAFDPEQKPLHGVLKTPTSSP

Rabbit polyclonal Alpha enolase antibody (biotin)

The EGFR antibody is a cytotoxic monoclonal antibody that targets the epidermal growth factor receptor (EGFR). It is used as a diagnostic reagent in the field of life sciences to detect and measure the levels of EGFR protein biomarkers. This antibody specifically recognizes and binds to EGFR, inhibiting its activation and downstream signaling pathways. By blocking the interaction between EGFR and its ligands, such as epidermal growth factor, the antibody effectively inhibits cell proliferation and survival. The EGFR antibody has been extensively studied for its potential therapeutic applications in cancer treatment, particularly in tumors that overexpress EGFR. Additionally, this antibody has shown promising results in preclinical studies as a potential nephrotoxic agent due to its ability to inhibit hydroxylase activity. Overall, the EGFR antibody is a valuable tool for researchers and clinicians in studying and targeting EGFR-related diseases.

Purified Polyclonal RPL28 antibody

Rabbit polyclonal RPS25 antibody (FITC)

ADSS antibody was raised in Rabbit using Human ADSS as the immunogen

Affinity purified Rabbit polyclonal HSP70s antibody

Heparin antibody is a monoclonal antibody that is used to detect and diagnose heparin-induced thrombocytopenia (HIT), a condition in which the body's immune system produces antibodies against heparin, a commonly used blood thinner. This antibody specifically targets the complex formed between heparin and platelet factor 4 (PF4), which is responsible for the immune response leading to HIT. Heparin antibody can also be used in research settings to study the interactions between heparin and other molecules, such as insulin. Additionally, this antibody has been used in the development of therapeutic monoclonal antibodies, such as trastuzumab, which is used to treat certain types of cancer. Its high specificity and sensitivity make it a valuable tool in various applications within the field of life sciences.

Monoclonal antibody against RANKL; anti-resorptive agent for osteoperosis treatment

Please enquire for more information about HBsAg Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page

Please enquire for more information about Dengue Virus Type 1 Envelope Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page

CA 125 antibody (biotin) was raised in mouse using affinity pure human CA 125 antigen as the immunogen.

Cortisol antibody was raised in mouse using cortisol-3 BSA as the immunogen.