Anticorps primaires

Rabbit polyclonal AP2S1 antibody (HRP)

Affinity purified Rabbit polyclonal PODXL2 antibody

CKMT1A antibody was raised in Rabbit using Human CKMT1A as the immunogen

BAG5 antibody was raised in rabbit using the C terminal of BAG5 as the immunogen

MMACHC antibody was raised in rabbit using the C terminal of MMACHC as the immunogen

Affinity purified Rabbit polyclonal Calpain 5 antibody

Affinity purified Rabbit polyclonal GPR164 antibody

Rabbit polyclonal TAF1A antibody

Rabbit polyclonal Osteocalcin antibody (FITC)

The Survivin antibody is a monoclonal antibody that targets survivin, a protein that plays a crucial role in cell division and inhibition of apoptosis. This antibody specifically binds to survivin and can be used for various applications in Life Sciences research.

Rabbit polyclonal MAPT antibody

UXT antibody was raised using the N terminal of UXT corresponding to a region with amino acids MATPPKRRAVEATGEKVLRYETFISDVLQRDLRKVLDHRDKVYEQLAKYL

Affinity purified Rabbit polyclonal GNAS antibody

Rabbit polyclonal MRCKB antibody

The PPM1B antibody is a monoclonal antibody that targets the phosphatase enzyme PPM1B. It has been extensively studied in the field of Life Sciences and has shown promising results in various applications. This antibody specifically recognizes and binds to PPM1B, inhibiting its activity and preventing its interaction with other molecules.

Affinity purified Rabbit polyclonal FSD2 antibody

ATP6V1A antibody was raised in Rabbit using Human ATP6V1A as the immunogen

The Lactadherin antibody is a powerful tool used in the field of Life Sciences. This antibody has shown to have cytotoxic effects on tumor cells and can inhibit the growth of microvessels, which are essential for tumor development. It specifically targets TNF-α, a cytokine involved in inflammation and immune response. The Lactadherin antibody can be used in combination with other antibodies, such as adalimumab, to enhance its therapeutic effects. It works by activating protein kinases and phosphatases, which regulate cell growth and survival pathways. Whether you need a polyclonal or monoclonal antibody, the Lactadherin antibody is an excellent choice for your research needs.

The SOD2 antibody is a polyclonal antibody that specifically targets the superoxide dismutase 2 (SOD2) protein. This antibody is commonly used in life sciences research to study the role of SOD2 in various cellular processes.

R3HDM2 antibody was raised using the middle region of R3HDM2 corresponding to a region with amino acids QSTYTVHQGQSGLKHGNRGKRQALKSASTDLGTADVVLGRVLEVTDLPEG

The PDIA4 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It is designed to target and bind to the PDIA4 antigen, which is an extracellular enzyme involved in various cellular processes. This antibody has been extensively tested and proven to be effective in detecting and quantifying PDIA4 levels in human serum samples.

Rabbit polyclonal 5HT1A antibody

NFS1 antibody was raised using a synthetic peptide corresponding to a region with amino acids TTQTEHKCVLDSCRSLEAEGFQVTYLPVQKSGIIDLKELEAAIQPDTSLV

Rabbit polyclonal SERC3 antibody

ATP6V1G3 antibody was raised in Rabbit using Human ATP6V1G3 as the immunogen

The Livin antibody is a powerful tool in Life Sciences research. It specifically targets mesothelin, a protein that is often overexpressed in various types of cancer. By binding to mesothelin, the Livin antibody can be used to detect and measure its presence in human serum samples. Studies have shown that high levels of mesothelin are associated with increased microvessel density and tumor growth, making it an important marker for cancer prognosis and treatment.

Rabbit polyclonal CHMP2A antibody (HRP)

FGF19 antibody is a highly specialized drug antibody that targets fibroblast growth factor 19 (FGF19). FGF19 is a growth factor that plays a crucial role in regulating the metabolism of fatty acids. This antibody has been developed for use in antiestrogen therapy, as it can effectively block the activity of FGF19 and inhibit its effects on adipose tissue.

Affinity purified Rabbit polyclonal FAM122B antibody

The MCM5 antibody is a polyclonal antibody that is used for immobilization in various assays. It can be used to detect the presence of MCM5 protein in human serum or other samples. This antibody can be immobilized on an electrode surface, allowing for the detection and quantification of MCM5 protein levels. The MCM5 antibody recognizes specific hormone peptides and fatty acids that are associated with the activation of MCM5. It can also be used as a tool to study the interaction between MCM5 and other molecules, such as tyrosine inhibitors or monoclonal antibodies. Molecular docking studies have shown that this antibody has a high affinity for activated MCM5, making it an effective tool for research purposes. Additionally, colloidal gold-labeled versions of this antibody can be used for immunohistochemical staining to visualize the expression of MCM5 in tissue samples.

The BAK1 antibody is a test compound used in Life Sciences research. It is a protein reagent that is commonly used in the field of Antibodies. This antibody specifically targets hematopoietic cells and can be used to study their function in various biological processes. The BAK1 antibody has high affinity for its target and can be used as an inhibitor to block specific interactions or signaling pathways. Additionally, it has been shown to have therapeutic potential in the field of pluripotent stem cell research, where it can be used to manipulate DNA double-strand breaks and promote cellular differentiation. With its versatility and wide range of applications, the BAK1 antibody is an essential tool for researchers in the Life Sciences field.

The FER antibody is a powerful tool used in life sciences research for the detection and analysis of messenger RNA (mRNA). It belongs to the category of antibodies, specifically polyclonal antibodies. This cytotoxic antibody is designed to target specific proteins, particularly glycoproteins, and can be used for various applications such as protein immobilization and chromatographic purification. The FER antibody has the unique ability to neutralize binding proteins, including growth factors like hepatocyte growth factor and angiopoietin-like 3 (ANGPTL3). Its high specificity and sensitivity make it an invaluable asset in the field of molecular biology and biomedical research.

Affinity purified Goat polyclonal Presenilin 2 antibody

The RPA70 antibody is a highly specific reagent used in scientific research for various applications. It is commonly used in polymerase chain reactions (PCR) and immunohistochemical detection to study protein-protein interactions and cellular processes. This polyclonal antibody recognizes the RPA70 protein, which plays a crucial role in DNA replication and repair.

Affinity purified Rabbit polyclonal GIMAP8 antibody

The RALB antibody is a powerful tool in the field of Life Sciences. It is a polyclonal antibody that specifically targets the RALB protein, which plays a crucial role in various cellular processes such as epidermal growth factor signaling, low-molecular-weight chemokine production, and endothelial cell growth. This antibody has been extensively used in research to study the function and regulation of RALB.

Affinity purified Rabbit polyclonal Glucocorticoid Receptor beta antibody

The IDO antibody is a highly specialized product used in Life Sciences research. It is a monoclonal antibody that specifically targets the enzyme indoleamine 2,3-dioxygenase (IDO). This enzyme plays a crucial role in the regulation of immune responses and is involved in various physiological processes. The IDO antibody has been extensively used to study the function and activity of IDO in different cell types and tissues.

Tropomyosin 1 antibody was raised using a synthetic peptide corresponding to a region with amino acids DRAEQAEADKKAAEDRSKQLEDELVSLQKKLKGTEDELDKYSEALKDAQE

The PINX1 antibody is a powerful tool used in life sciences research. It is a polyclonal antibody that specifically targets and neutralizes the PINX1 protein. This protein is found in various tissues, including liver microsomes, and plays a role in regulating important cellular processes such as dopamine signaling, oncostatin production, and β-catenin localization within the nucleus.

Rabbit polyclonal ELF1 antibody

The CDC2 antibody is a highly specialized antibody used in the field of Life Sciences. It is derived from blood monocytes and is available as both polyclonal and monoclonal antibodies. The CDC2 antibody is commonly used in research laboratories to study various cellular processes and pathways.

Affinity purified Rabbit polyclonal CaMKII delta antibody

ALDOA antibody was raised in Rabbit using Human ALDOA as the immunogen

Affinity purified Rabbit polyclonal dUTPase antibody

The GAPDH antibody is a highly specialized monoclonal antibody used in Life Sciences research. It plays a crucial role in various applications such as immunoblotting, immunoprecipitation, and immunohistochemistry. This antibody specifically targets the glyceraldehyde-3-phosphate dehydrogenase (GAPDH) enzyme, which is involved in glycolysis and other metabolic pathways.

The ARAF antibody is a highly specialized monoclonal antibody that targets and neutralizes the ARAF protein. This protein plays a crucial role in cell growth and division, making it an important target for cancer therapy. The ARAF antibody binds to the ARAF protein, preventing its activation and inhibiting tumor growth.

Rabbit polyclonal ALAS1 antibody raised against the N terminal of ALAS1

Affinity purified Rabbit polyclonal G-Catenin antibody

Rabbit polyclonal DGKQ antibody

ACADVL antibody was raised in Rabbit using Human ACADVL as the immunogen

Tetraspanin 32 antibody was raised using the middle region of TSPAN32 corresponding to a region with amino acids EDCLQGIRSFLRTHQQVASSLTSIGLALTVSALLFSSFLWFAIRCGCSLD

CCNE2 antibody was raised in rabbit using the N terminal of CCNE2 as the immunogen

Affinity purified Rabbit polyclonal IP6K1 antibody

RPL7 antibody was raised in rabbit using the C terminal of RPL7 as the immunogen

PTHLH antibody was raised using the middle region of PTHLH corresponding to a region with amino acids YKEQPLKTPGKKKKGKPGKRKEQEKKKRRTRSAWLDSGVTGSGLEGDHLS

Factor IX antibody (biotin) was raised in goat using human Factor IX purified from plasma as the immunogen.

The Interferon alpha Receptor 1 antibody is a highly specialized polyclonal antibody that is used in immunoassays. This antibody specifically targets the Interferon alpha Receptor 1 protein, which plays a crucial role in the immune response. It can be used for various applications, including Western blotting, immunoprecipitation, and immunohistochemistry.

UTS2D antibody was raised in rabbit using the C terminal of UTS2D as the immunogen

CD45.2 antibody was raised in mouse using CD45.2 as the immunogen.

PAIP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids EPTFYTSDGVPFTAADPDYQEKYQELLEREDFFPDYEENGTDLSGAGDPY

The LHR antibody is a polyclonal antibody used in life sciences research. It specifically targets the luteinizing hormone receptor (LHR), which plays a crucial role in reproductive processes. This antibody is commonly used to study the interaction between LHR and various ligands, such as chemokines, on the microvascular endothelium. It can also be used in antigen-antibody reactions to detect the presence of LHR in different tissues or cell types. The LHR antibody is available as both polyclonal and monoclonal antibodies, providing researchers with options for their specific experimental needs. With its high specificity and sensitivity, this antibody is an invaluable tool for investigating the function and regulation of LHR in various biological contexts.

CHMP1B antibody was raised in Rabbit using Human CHMP1B as the immunogen

Collagen type IV antibody (biotin) was raised in rabbit using collagen type IV from human and bovine placenta as the immunogen.

DDT antibody is an activated phosphatase that belongs to the class of monoclonal antibodies. It is used in life sciences research for various applications, including immunohistochemistry, Western blotting, and ELISA. DDT antibody specifically binds to DDT (dichlorodiphenyltrichloroethane), a synthetic insecticide that was widely used in the past but has since been banned due to its harmful effects on the environment and human health. This antibody can be used to detect and neutralize DDT in samples such as human serum or environmental samples. It has high affinity and specificity for DDT and does not cross-react with other compounds. The DDT antibody is conjugated with a fluorescent or enzymatic tag, allowing for easy detection and quantification of DDT in various assays.

Affinity purified Rabbit polyclonal Docking protein 3 antibody

The CD22 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It is designed to target the CD22 protein, which plays a crucial role in immune response regulation. This antibody can be used for various applications, including the study of tyrosine signaling pathways, the development of recombinant proteins, and the identification of growth factor inhibitors.

Rabbit polyclonal RPL36A antibody

The S100B antibody is a highly specialized product in the field of Life Sciences. It is an antibody derived from human immunoglobulin that specifically targets the growth hormone receptor. This monoclonal antibody has been developed as a chimeric protein, which enhances its efficacy and specificity.

CD3E antibody was raised in Rabbit using Human CD3E as the immunogen

Collagen type II antibody was raised in mouse using purified preparation of lathritic type II collagen from embryonic chicken sternum as the immunogen.

HTR7 antibody was raised in rabbit using the N terminal of HTR7 as the immunogen

Rabbit polyclonal PPIL1 antibody

Affinity purified Rabbit polyclonal HS1BP3 antibody

Thrombospondin antibody is a powerful tool used in Life Sciences research to study various biological processes. It specifically targets and detects the presence of thrombospondin, a protein involved in cell growth, angiogenesis, and wound healing. This antibody can be used in various applications such as immunohistochemistry, Western blotting, and enzyme-linked immunosorbent assay (ELISA). By binding to thrombospondin, this antibody allows researchers to investigate its role in different cellular pathways and understand its interactions with other molecules like epidermal growth factor (EGF), alpha-fetoprotein, serotonin, and c-myc. With its high specificity and sensitivity, the thrombospondin antibody provides valuable insights into the molecular mechanisms underlying these processes.

Affinity purified Rabbit polyclonal ENTPD6 antibody

Rabbit polyclonal RPS14 antibody (biotin)

RGS20 antibody was raised using the N terminal of RGS20 corresponding to a region with amino acids KHFSRPSIWTQFLPLFRAQRYNTDIHQITENEGDLRAVPDIKSFPPAQLP

Affinity purified Rabbit polyclonal Integrin alpha 2b antibody

Affinity purified Rabbit polyclonal KLRC4 antibody

CTSL2 antibody was raised in rabbit using the C terminal of CTSL2 as the immunogen

U1SNRNPBP antibody was raised using the N terminal of U1SNRNPBP corresponding to a region with amino acids RAVWRAMLARYVPNKGVIGDPLLTLFVARLNLQTKEDKLKEVFSRYGDIR

The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug from the rifamycin class. It is highly effective in treating tuberculosis infections and contains active compounds that exhibit bactericidal activity. Through its binding to DNA-dependent RNA polymerase, this drug inhibits bacterial growth by preventing transcription and replication. The efficacy of this drug has been demonstrated through patch-clamp technique studies on human erythrocytes. Metabolically, it undergoes various transformations such as hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed in Mycobacterium tuberculosis strains, inhibiting their growth in culture.

CLYBL antibody was raised in Rabbit using Human CLYBL as the immunogen

Please enquire for more information about HBsAg Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page

Please enquire for more information about Dengue Virus Type 1 Envelope Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page

Monoclonal antibody against RANKL; anti-resorptive agent for osteoperosis treatment

CA 125 antibody (biotin) was raised in mouse using affinity pure human CA 125 antigen as the immunogen.

Cortisol antibody was raised in mouse using cortisol-3 BSA as the immunogen.