Anticorps primaires
Sous-catégories appartenant à la catégorie "Anticorps primaires"
- Anticorps pour la recherche sur le cancer(3.721 produits)
- Anticorps cardio-vasculaires(2 produits)
- Biologie du développement(764 produits)
- Anticorps relatifs à l’épigénétique(162 produits)
- Anticorps d'immunologie(2.585 produits)
- Anticorps du métabolisme(286 produits)
- Anticorps de microbiologie(741 produits)
- Transduction du signal(2.765 produits)
- Tags & Marqueurs cellulaires(34 produits)
75594 produits trouvés pour "Anticorps primaires"
HAO1 antibody
The HAO1 antibody is a monoclonal antibody that specifically targets and binds to the HAO1 protein. This antibody has been extensively studied in the field of life sciences and has shown promising results in various applications.
RNASE1 antibody
The RNASE1 antibody is a monoclonal antibody that specifically targets and binds to RNASE1, an enzyme involved in the breakdown of RNA molecules. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in various research areas.
Protein C antibody (HRP)
Protein C antibody (HRP) was raised in sheep using human Protein C purified from plasma as the immunogen.
beta Amyloid antibody
The beta Amyloid antibody is a powerful tool in the field of Life Sciences. It is a polyclonal antibody that specifically targets the amyloid protein, which is associated with various neurodegenerative disorders such as Alzheimer's disease. This antibody has been extensively tested and validated for use in immunoassays, making it an essential component in research and diagnostic applications.
CD11b antibody
CD11b antibody is a monoclonal antibody that specifically targets CD11b, a cell surface protein involved in various immune responses. This antibody has been shown to neutralize the activity of CD11b and inhibit its function in immune cells. CD11b antibody has been used in research studies to investigate the role of CD11b in different biological processes, including hepcidin regulation, interleukin-6 signaling, and syncytia formation. It has also been shown to modulate intracellular signaling pathways such as the p38 MAPK pathway and protein kinases. This antibody is widely used in life sciences research for its ability to selectively bind and block CD11b activity, making it a valuable tool for studying immune responses and developing potential therapeutic interventions.
DDX4 antibody
The DDX4 antibody is a monoclonal antibody that specifically targets the DDX4 cell antigen. This antibody plays a crucial role in various cellular processes, including exocytosis and phosphatase activity. It has been shown to modulate the production of interleukin-6 (IL-6), a key cytokine involved in immune responses. The DDX4 antibody also exhibits high specificity towards antigens such as hemagglutinin, transferrin, and glycosylation markers. In Life Sciences research, this antibody is widely used for nuclear staining and detection of DDX4 expression. Its unique binding properties make it an invaluable tool for studying cellular processes and protein interactions. With its exceptional performance and reliability, the DDX4 antibody is the go-to choice for researchers in the field of immunology and molecular biology.
PGR antibody
PGR antibody was raised in Mouse using a purified recombinant fragment of PGR(aa731-909) expressed in E. coli as the immunogen.alpha Actin antibody
The alpha Actin antibody is a highly specialized monoclonal antibody that targets the alpha actin protein. This protein plays a crucial role in muscle contraction and cell motility. The antibody is capable of neutralizing the activity of alpha actin, making it an invaluable tool for researchers in the field of Life Sciences.
KCNQ5 antibody
The KCNQ5 antibody is a highly specialized biomolecule used in Life Sciences research. It is a monoclonal antibody that specifically targets and detects the KCNQ5 protein, which plays a crucial role in various cellular processes. This antibody has been extensively tested and proven to be highly sensitive, allowing for ultrasensitive detection of KCNQ5 in biological samples.
RPESP antibody
RPESP antibody was raised using the middle region of RPESP corresponding to a region with amino acids LRCSGDGLDSDGNQTLHWQAIGNPRCQGTWKKVRRVDQCSCPAVHSFIFI
HSPA9 antibody
The HSPA9 antibody is a highly specialized product in the field of Life Sciences. It is an antibody that specifically targets HSPA9, also known as heat shock 70kDa protein 9. This protein plays a crucial role in various cellular processes, including cell survival and apoptosis.
ZNF567 antibody
ZNF567 antibody was raised in rabbit using the N terminal of ZNF567 as the immunogenDegré de pureté :Min. 95%uPAR antibody
The uPAR antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It specifically targets the urokinase plasminogen activator receptor (uPAR), which plays a crucial role in various biological processes such as cell adhesion, migration, and invasion. The uPAR antibody binds to the glycopeptide domain of uPAR, inhibiting its function and preventing the activation of downstream signaling pathways.
HMBS antibody
HMBS antibody was raised using the N terminal of HMBS corresponding to a region with amino acids MRVIRVGTRKSQLARIQTDSVVATLKASYPGLQFEIIAMSTTGDKILDTA
SYT1 antibody
The SYT1 antibody is a highly effective polyclonal antibody that targets angptl3, a glycoprotein involved in various biological processes. This antibody can be used in chromatographic techniques for protein purification and immobilization, making it an essential tool in life sciences research. Additionally, the SYT1 antibody has neutralizing properties against inhibitors of growth factors, such as collagen, making it a valuable asset in cytotoxic studies. Whether you're conducting experiments or developing therapeutic strategies, the SYT1 antibody is a reliable choice for your research needs.
Dog RBC antibody
Canine RBC antibody was raised in rabbit using canine erythrocyets as the immunogen.PPP4C antibody
PPP4C antibody was raised using a synthetic peptide corresponding to a region with amino acids TVLTVWSAPNYCYRCGNVAAILELDEHLQKDFIIFEAAPQETRGIPSKKP
Selenophosphate synthetase 1 antibody
Affinity purified Rabbit polyclonal Selenophosphate synthetase 1 antibody
VAV1 antibody
The VAV1 antibody is a highly specialized polyclonal antibody that targets the VAV1 protein. This protein plays a crucial role in endothelial growth and has been implicated in various biological processes. The VAV1 antibody is available as both polyclonal and monoclonal antibodies, allowing for versatile applications in life sciences research.
Ubiquitin antibody (Prediluted for IHC)
Rabbit polyclonal Ubiquitin antibody (Prediluted for IHC)
Degré de pureté :Min. 95%IGFBP3 antibody
IGFBP3 antibody is a stable chemical compound that plays a crucial role in the field of Life Sciences. It is a monoclonal antibody that specifically targets and neutralizes IGFBP3, which stands for insulin-like growth factor binding protein 3. This antibody has been extensively used in research and diagnostics to study the aberrant methylation and oxidative damage associated with IGFBP3.
Keratin K16 antibody
Keratin K16 antibody was raised in Guinea Pig using synthetic peptide of human keratin K16 coupled to KLH as the immunogen.
Degré de pureté :Min. 95%LBP antibody
The LBP antibody is a monoclonal antibody that targets sumoylation, interleukins, and inhibitors. It is widely used in the field of Life Sciences for various applications. This antibody specifically recognizes and binds to tyrosine residues on proteins, including interferon-gamma and growth factors. It can be used for immunohistochemistry, western blotting, and other protein detection methods. The LBP antibody is also available as polyclonal antibodies and recombinant proteins for different research needs. With its high specificity and sensitivity, this antibody is an essential tool for studying protein interactions, signal transduction pathways, and diseases such as alpha-synuclein-related disorders.
MMP16 antibody
The MMP16 antibody is a highly effective substance used in Life Sciences research. It is a monoclonal antibody that specifically targets the matrix metalloproteinase 16 (MMP16), also known as MT3-MMP. This antibody has been extensively studied and proven to be highly specific and sensitive in detecting MMP16 expression in various tissues and cell types.
CD45 antibody
The CD45 antibody is a growth factor that plays a crucial role in various biological processes. It is a glycoprotein with sugar moieties and contains domains similar to epidermal growth factor (EGF) and transforming growth factor-beta (TGF-beta). This antibody has been extensively studied in the field of Life Sciences and has shown promising results.
HSPA4 antibody
HSPA4 antibody was raised using the N terminal of HSPA4 corresponding to a region with amino acids PACISFGPKNRSIGAAAKSQVISNAKNTVQGFKRFHGRAFSDPFVEAEKS
PDE4D antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug belonging to the class of rifamycins. It is specifically designed to combat tuberculosis infections by targeting active compounds and exhibiting bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, preventing transcription and replication, thus inhibiting bacterial growth. Its efficacy has been extensively studied using advanced techniques like transcription-quantitative polymerase chain and patch-clamp technique. Additionally, it undergoes various metabolic transformations such as hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Furthermore, it specifically targets markers expressed in Mycobacterium tuberculosis strains, inhibiting their growth in culture.
IRF2BP1 antibody
IRF2BP1 antibody was raised using the middle region of IRF2BP1 corresponding to a region with amino acids LVARNGEAEVSPTAGAEAVSGGGSGTGATPGAPLCCTLCRERLEDTHFVQ
BRCA1 antibody
The BRCA1 antibody is a growth factor that has been extensively studied in the field of Life Sciences. It has shown promising results in various experiments, including phorbol-induced differentiation and interferon-mediated signaling pathways. This monoclonal antibody has been used for neutralizing experiments, electrophoresis, and as an electrode in various research studies. The BRCA1 antibody is produced using a state-of-the-art lyophilization method to ensure its stability and efficacy. It is also available as an anticoagulant for specific applications. This antibody is highly specific and can be used to detect autoantibodies or as a tool for studying the expression of BRCA1 protein in different tissues.
Caspase 1 antibody
The Caspase 1 antibody is a highly effective tool for immunoassays and research purposes. This antibody specifically targets caspase 1, a key enzyme involved in inflammatory responses and cell death. It has been shown to neutralize the activity of caspase 1, making it an essential component for studies related to fibronectin, insulin, collagen, β-catenin, and other growth factors.
Helicobacter pylori antibody (CagA protein)
Mouse monoclonal CagA protein antibody (Helicobacter pylori)CEP55 antibody
CEP55 antibody was raised using the N terminal of CEP55 corresponding to a region with amino acids MSSRSTKDLIKSKWGSKPSNSKSETTLEKLKGEIAHLKTSVDEITSGKGK
YTHDF1 antibody
The YTHDF1 antibody is a highly specialized monoclonal antibody that targets the YTH domain family protein 1 (YTHDF1). This peptide system plays a crucial role in various biological processes, including RNA metabolism and translation regulation. The YTHDF1 antibody is designed to specifically bind to YTHDF1 and neutralize its activity.
MOV10 antibody
MOV10 antibody was raised using a synthetic peptide corresponding to a region with amino acids AKLDLQQGQNLLQGLSKLSPSTSGPHSHDYLPQEREGEGGLSLQVEPEWR
Endostatin antibody
Endostatin antibody was raised in Mouse using recombinant endostatin as the immunogen.Degré de pureté :≥85% By Sds-PageNEDD1 antibody
NEDD1 antibody was raised using the N terminal of NEDD1 corresponding to a region with amino acids MQENLRFASSGDDIKIWDASSMTLVDKFNPHTSPHGISSICWSSNNNFLV
Ela1 antibody
Ela1 antibody was raised in rabbit using the middle region of Ela1 as the immunogenDegré de pureté :Min. 95%Semenogelin I antibody
Semenogelin I antibody was raised using the N terminal of SEMG1 corresponding to a region with amino acids QKGKQQTESKGSFSIQYTYHVDANDHDQSRKSQQYDLNALHKTTKSQRHL
HAO1 antibody
HAO1 antibody was raised using a synthetic peptide corresponding to a region with amino acids GLNGILVSNHGARQLDGVPATIDVLPEIVEAVEGKVEVFLDGGVRKGTDV
Denosumab
CAS :Monoclonal antibody against RANKL; anti-resorptive agent for osteoperosis treatment
Degré de pureté :(Sec-Hplc) Min. 95 Area-%Couleur et forme :Clear LiquidHBsAg Mouse Monoclonal Antibody
Please enquire for more information about HBsAg Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page
Degré de pureté :Min. 95%Dengue Virus Type 1 Envelope Antigen, Recombinant
Please enquire for more information about Dengue Virus Type 1 Envelope Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page
Degré de pureté :Min. 95%CA 125 antibody (biotin)
CA 125 antibody (biotin) was raised in mouse using affinity pure human CA 125 antigen as the immunogen.
