Anticorps primaires

CD51 antibody (PE) was raised in mouse using human CD51 as the immunogen.

Rabbit polyclonal Cytochrome P450 39A1 antibody

ABHD14A antibody was raised in Rabbit using Human ABHD14A as the immunogen

Neu antibody was raised in mouse using Intact SKBR-3 breast cancer cells as the immunogen.

Rabbit polyclonal VPS45 antibody

Affinity purified Rabbit polyclonal PPP1R12A antibody

SCO1 antibody was raised using a synthetic peptide corresponding to a region with amino acids ALLAGMKHVKKEKAEKLEKERQRHIGKPLLGGPFSLTTHTGERKTDKDYL

CD4 antibody (PE) was raised in mouse using feline CD4 as the immunogen.

GOLM1 antibody was raised in Rabbit using Human GOLM1 as the immunogen

Affinity purified Rabbit polyclonal Fumarate Hydratase antibody

CD102 antibody (PE) was raised in rat using COS cells transfected with mouse ICAM-2 cDNA as the immunogen.

The AKR1C1 antibody is a monoclonal antibody that has been developed for use in Life Sciences research. It specifically targets and binds to AKR1C1, a protein that is involved in various cellular processes. This antibody has been shown to be effective in detecting the presence of AKR1C1 in samples such as human serum and tissue sections.

Affinity purified Rabbit polyclonal Cytokeratin 13 antibody

The CDKL3 antibody is a cytotoxic monoclonal antibody that targets the oncostatin growth factor. It is commonly used in Life Sciences research to study the role of CDKL3 in various cellular processes. This antibody specifically binds to CDKL3, a protein involved in cell proliferation and differentiation. It has been shown to inhibit the growth of cancer cells by blocking the signaling pathway mediated by CDKL3. Additionally, the CDKL3 antibody has been used in hybridization studies to detect the expression of CDKL3 in different tissues and cell types. Its specificity and high affinity make it a valuable tool for researchers studying the function of CDKL3 and its potential as a therapeutic target for cancer treatment.

CHRNA6 antibody was raised in Rabbit using Human CHRNA6 as the immunogen

Rabbit polyclonal CDK1 antibody (Tyr15)

The ADRB3 antibody is a powerful tool used in Life Sciences research. It specifically targets the adrenergic receptor beta 3 (ADRB3), which plays a crucial role in various physiological processes. This monoclonal antibody can be used to study the function and localization of ADRB3 in different tissues and cell types.

Rabbit polyclonal NR2C1 antibody

Mouse monoclonal FBP2 antibody

Purified Polyclonal TAC1 antibody

Rabbit polyclonal EDG2 antibody

The Bcl-2 antibody is a powerful tool in the field of immunology. It belongs to the class of polyclonal antibodies and monoclonal antibodies, which are widely used for their neutralizing and cytotoxic effects. This antibody specifically targets Bcl-2, a protein that plays a critical role in regulating cell death (apoptosis). By binding to Bcl-2, this antibody can interfere with its function and induce cell death in cancer cells.

Affinity purified Rabbit polyclonal PSMC6 antibody

The STAC3 antibody is a recombinant antigen that has shown potential in the treatment of non-alcoholic steatohepatitis (NASH). This effective substance belongs to the class of antibodies, which are proteins that can specifically bind to certain molecules in the body. The STAC3 antibody has been tested as a test substance for its ability to inhibit protein kinase activity, an enzyme involved in various cellular processes. Inhibitors of protein kinases have been studied extensively in Life Sciences for their potential therapeutic applications.

Affinity purified Rabbit polyclonal MEL1AR antibody

This antibody reacts with heavy (gamma) chains on mouse IgG and light chains on all mouse immunoglobulins.

Affinity purified Rabbit polyclonal UNC13B antibody

The TEX14 antibody is a protein that acts as a growth factor, specifically targeting epidermal growth factor and hepatocyte growth inhibitory factor. It is an essential component in the field of Life Sciences and is widely used in research studies. The TEX14 antibody can be utilized as both a monoclonal and polyclonal antibody, making it versatile for various applications. Its high specificity allows for accurate detection and analysis of c-myc expression levels. Additionally, the TEX14 antibody has been found to be effective in detecting autoantibodies, making it valuable in diagnostic testing. With its robust capabilities, this antibody is an indispensable tool for researchers in the field.

CD69 antibody (biotin) was raised in hamster using Y245 murine dendritic epidermal T cell line as the immunogen.

Affinity purified Goat anti Human IgG antibody

CTNNB1 antibody was raised in rabbit using the C terminal of CTNNB1 as the immunogen

sRANKL antibody (biotin) was raised in goat using highly pure recombinant human sRANKL as the immunogen.

ZNF419A antibody was raised in rabbit using the C terminal of ZNF419A as the immunogen

Rabbit polyclonal ISG15 antibody (HRP)

The ELF5 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It plays a crucial role in studying neurotrophic factors and their effects on progesterone concentration and steroid metabolism. This antibody is specifically designed to target and bind to ELF5, a transcription factor involved in the regulation of various angiogenic factors such as arginase, angptl3, TGF-beta, and growth factor-2.

Rabbit polyclonal SYT1 antibody (Ser309)

Affinity purified Rabbit polyclonal IBSP antibody

The FZD8 antibody is a diagnostic reagent that plays a crucial role in the field of Life Sciences. It is an antigen-specific antibody that specifically targets and binds to the FZD8 protein. This antibody is widely used in various research applications, including immunohistochemistry, western blotting, and flow cytometry.

The SOCS3 antibody is a polyclonal antibody that is widely used in the field of Life Sciences. It specifically targets annexin A2, a protein involved in various cellular processes such as erythropoietin signaling, low-density lipoprotein endocytosis, and epidermal growth factor receptor trafficking. This antibody is commonly used in research studies to investigate the role of annexin A2 in different biological pathways.

The SH2 antibody is a polyclonal antibody that has cytotoxic properties. It is commonly used in the field of Life Sciences for research purposes. This antibody specifically targets and inhibits the activity of family kinases, making it an effective inhibitor for various cellular processes. Additionally, the SH2 antibody has been shown to have neutralizing effects on proteins such as VEGF (vascular endothelial growth factor) and circumsporozoite protein. It can also be utilized in studies involving mesenchymal stem cells and has shown promising results in inhibiting their growth. The SH2 antibody is a valuable tool for researchers looking to study specific cellular pathways and investigate potential therapeutic targets.

BMPER antibody was raised using the C terminal of BMPER corresponding to a region with amino acids NGHKRDDLIGGDGNFKFDVDDFAESWRVESNEFCNRPQRKPVPELCQGTV

Rabbit Polyclonal Synuclein antibody (Ser129)

ABCB1 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.

CRISPR/Cas9 Monoclonal Antibody (HRP)

Purified Polyclonal SLC6A8 antibody

Goat anti-rat IgM (FITC) was raised in goat using rat IgM mu chain as the immunogen.

CDC2L6 antibody was raised in Rabbit using Human CDC2L6 as the immunogen

Affinity purified Rabbit polyclonal IDH3G antibody

BIN3 antibody was raised in Rabbit using Human BIN3 as the immunogen

TNFRSF25 antibody was raised in rabbit using the middle region of TNFRSF25 as the immunogen

Loricrin antibody was raised using the N terminal of LOR corresponding to a region with amino acids GYSGGGCGGGSSGGGGGGGIGGCGGGSGGSVKYSGGGGSSGGGSGCFSSG

Rabbit polyclonal Wheat Gliadin antibody

STEAP3 antibody was raised using the C terminal of STEAP3 corresponding to a region with amino acids VALVLSTLHTLTYGWTRAFEESRYKFYLPPTFTLTLLVPCVVILAKALFL

CA 50 antibody was raised in mouse using human CA50 antigen as the immunogen.

CD2 antibody (PE) was raised in rat using CD2/LFA-2 as the immunogen.

Rabbit polyclonal RAP1GAP antibody

Affinity purified Rabbit polyclonal Calpain 5 antibody

AMBRA1 antibody was raised in Rabbit using Human AMBRA1 as the immunogen

BNIPL antibody was raised in Rabbit using Human BNIPL as the immunogen

Tyrosine hydroxylase antibody was raised in mouse using mouse monoclonal as the immunogen.

MMACHC antibody was raised in rabbit using the C terminal of MMACHC as the immunogen

BAG5 antibody was raised in rabbit using the C terminal of BAG5 as the immunogen

GFP antibody (biotin) was raised in goat using a GFP fusion protein corresponding to the full length amino acid sequence (246aa) derived from the jellyfish Aequorea victoria as the immunogen.

CKMT1A antibody was raised in Rabbit using Human CKMT1A as the immunogen

Affinity purified Rabbit polyclonal PODXL2 antibody

Rabbit polyclonal AP2S1 antibody (HRP)

Rabbit Polyclonal CHK1 antibody (Ser317)

Rabbit polyclonal RPA2 antibody (FITC)

The RAC1 antibody is a monoclonal antibody that specifically targets the RAC1 protein complex. This antibody has a high affinity for RAC1 and can neutralize its activity. It is formulated with excipients such as globulin to ensure stability and effectiveness. The RAC1 antibody belongs to the family of Polyclonal Antibodies, which are widely used in Life Sciences research. It can be used as an antigen in various applications, including Western blotting, immunohistochemistry, and flow cytometry. This antibody is particularly useful for studying the role of RAC1 in cell growth, as well as its interaction with other proteins such as growth factors and mineralocorticoid receptors. Additionally, it has been shown to have low cross-reactivity with other proteins or lipoproteins. Researchers and scientists can rely on the high quality and specificity of this RAC1 antibody for their experiments and studies.

The DGKA antibody is a highly specific monoclonal antibody that targets the octanoyltransferase enzyme. It is widely used in various assays and research studies in the field of life sciences. This antibody plays a crucial role in identifying and analyzing the function of DGKA, which is involved in several important cellular processes.

Purified Polyclonal THRB antibody

NGFRAP1 antibody was raised in Rabbit using Human NGFRAP1 as the immunogen

DPY19L4 antibody was raised using a synthetic peptide corresponding to a region with amino acids APVAAVFAGSPQLMGAIKLCTGWMVTSLPLYNDDDLLKRNENIYQIYSKR

OVCA2 Antibody

Mouse monoclonal gp130 antibody (biotin)

The Calretinin antibody is a highly reactive monoclonal antibody that targets the growth factor calretinin. Calretinin is a protein that contains numerous acid residues and is primarily found in mesothelial cells. This antibody has been extensively validated using techniques such as polymerase chain reaction (PCR) and immunohistochemistry to ensure its specificity and reliability.

The Complement C3 antibody is a highly specialized growth factor that plays a crucial role in various biological processes. It is commonly used in research and diagnostic applications. This antibody specifically targets the complement component C3, which is an essential protein involved in the immune response. The Complement C3 antibody is available as both monoclonal and polyclonal antibodies, providing researchers with options based on their specific needs. These antibodies are designed to recognize and bind to different epitopes of the C3 protein, ensuring accurate and reliable results. In addition to its role in the immune system, the Complement C3 antibody has been shown to have antiangiogenic properties. It inhibits endothelial cell growth and angiogenesis, making it a valuable tool for studying these processes. The Complement C3 antibody is widely used in various fields of life sciences research, including immunology, molecular biology, and biochemistry. It can be used in techniques such as Western blotting, immunohistochemistry, flow

MTO1 antibody was raised in Rabbit using Human MTO1 as the immunogen

Monoclonal antibody against RANKL; anti-resorptive agent for osteoperosis treatment

Please enquire for more information about HBsAg Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page

Please enquire for more information about Dengue Virus Type 1 Envelope Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page

CA 125 antibody (biotin) was raised in mouse using affinity pure human CA 125 antigen as the immunogen.

Cortisol antibody was raised in mouse using cortisol-3 BSA as the immunogen.