Anticorps primaires
Sous-catégories appartenant à la catégorie "Anticorps primaires"
- Anticorps pour la recherche sur le cancer(3.721 produits)
- Anticorps cardio-vasculaires(2 produits)
- Biologie du développement(764 produits)
- Anticorps relatifs à l’épigénétique(162 produits)
- Anticorps d'immunologie(2.585 produits)
- Anticorps du métabolisme(286 produits)
- Anticorps de microbiologie(741 produits)
- Transduction du signal(2.765 produits)
- Tags & Marqueurs cellulaires(34 produits)
75594 produits trouvés pour "Anticorps primaires"
TGFBI antibody
The TGFBI antibody is a highly specialized product in the field of Life Sciences. It is an antibody that specifically targets and binds to the Transforming Growth Factor Beta-Induced (TGFBI) protein. This protein plays a crucial role in various biological processes, including cell adhesion, migration, and tissue development.
Complement C4 antibody
Complement C4 antibody was raised in goat using highly purified human complement protein as the immunogen.Degré de pureté :Min. 95%FGFR2 antibody
The FGFR2 antibody is a polyclonal antibody that targets the FGFR2 protein. It is commonly used in research and diagnostic applications in the field of Life Sciences. This antibody specifically recognizes the endogenous hematopoietic FGFR2 protein and can be used to detect its expression levels in various samples, such as human serum or tissue lysates.
Amylin antibody
The Amylin antibody is a powerful tool in the field of Life Sciences. This antibody has the ability to interfere with e-cadherin expression, making it an essential component for research related to cell adhesion and migration. It is available in both polyclonal and monoclonal forms, offering researchers flexibility in their experimental design.
Fetuin A antibody
Fetuin A antibody is a highly specific monoclonal antibody that targets the protein fetuin A. This protein plays a crucial role in various biological processes, including collagen synthesis, growth factor signaling, and protein kinase activation. The antibody recognizes specific acid residues on the fetuin A protein and effectively inhibits its activity.
Fukutin antibody
The Fukutin antibody is a specific antibody that belongs to the group of Polyclonal Antibodies. It is an immunosuppressant and growth factor that plays a crucial role in various biological processes. This antibody can be used in research laboratories for studying protein-protein interactions, as well as in clinical settings for diagnostic purposes.
Chloramphenicol antibody
The Chloramphenicol antibody is a highly specialized polyclonal antibody used in the field of Life Sciences. It is designed to specifically target and bind to chloramphenicol, a medicament commonly used as an anticoagulant in medical treatments. This antibody is capable of recognizing and binding to the molecule drug with high affinity and specificity.Degré de pureté :Min. 95%CD82 antibody
The CD82 antibody is a powerful tool in the field of Life Sciences. It acts as a phosphatase that regulates various cellular processes by binding to specific proteins. This antibody has been shown to inhibit the production of interleukin-6, a pro-inflammatory cytokine involved in immune responses. Additionally, it can be used in antigen-antibody reactions to detect the presence of autoantibodies in patient samples.
ABHD7 antibody
ABHD7 antibody was raised using the N terminal of ABHD7 corresponding to a region with amino acids HCYVRIKDSGLRFHYVAAGERGKPLMLLLHGFPEFWYSWRYQLREFKSEY
Degré de pureté :Min. 95%FZD6 antibody
The FZD6 antibody is a highly specialized monoclonal antibody that targets the insulin-like growth factor receptor (IGF-1R). It is designed to specifically bind to the IGF-1R and inhibit its activity. This antibody has shown promising results in preclinical studies, demonstrating its potential as a therapeutic agent for various diseases, including cancer.
COX4 antibody
The COX4 antibody is a highly specialized antibody that targets the COX4 protein. This protein plays a crucial role in various biological processes, including energy production and cellular respiration. The COX4 antibody is widely used in life sciences research to study the function and regulation of this important protein.
RAMP2 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug belonging to the class of rifamycins. It is highly effective in treating tuberculosis infections as it has strong bactericidal activity. By binding to DNA-dependent RNA polymerase, it inhibits bacterial growth by preventing transcription and replication. This drug has been extensively studied using advanced techniques like transcription-quantitative polymerase chain and patch-clamp technique. It undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets Mycobacterium tuberculosis strains and inhibits their cell growth in culture.
BCAT1 antibody
The BCAT1 antibody is a highly specialized antibody that plays a crucial role in various biological processes. It is commonly used in Life Sciences research and has proven to be effective in studying the receptor binding of certain substances. This antibody is particularly useful in the field of oncology, as it can help researchers understand the mechanisms behind cancer growth and potentially develop targeted therapies.
CPA1 antibody
The CPA1 antibody is a monoclonal antibody used in the field of Life Sciences. It specifically targets and neutralizes tumor necrosis factor-alpha (TNF-α), a protein involved in inflammatory responses. This antibody has shown efficacy in blocking the activity of TNF-α, which plays a crucial role in various diseases and conditions. Studies have also demonstrated that the CPA1 antibody can inhibit the production of interleukin-6 and interferon, both of which are involved in immune responses. Additionally, this monoclonal antibody has been shown to bind to transferrin, a biomolecule involved in iron transport, as well as nuclear receptors. The CPA1 antibody holds promise for therapeutic applications due to its ability to target specific proteins and disrupt protein complexes involved in disease pathogenesis.
VDAC1 antibody
VDAC1 antibody was raised using the C terminal of VDAC1 corresponding to a region with amino acids SAKVNNSSLIGLGYTQTLKPGIKLTLSALLDGKNVNAGGHKLGLGLEFQA
TRSPAP1 antibody
TRSPAP1 antibody was raised using the middle region of TRSPAP1 corresponding to a region with amino acids KPVEYSQMYSYSYNQYYQQYQNYYAQWGYDQNTGSYSYSYPQYGYTQSTM
SLC26A10 antibody
SLC26A10 antibody was raised in rabbit using the N terminal of SLC26A10 as the immunogen
Degré de pureté :Min. 95%CXCL16 antibody
The CXCL16 antibody is a highly specialized monoclonal antibody that targets the chemokine CXCL16. It has been shown to have an inhibitory effect on the activation of this chemokine, making it a potential therapeutic option for various conditions. This antibody has also demonstrated an immobilization effect on steroids, further enhancing its potential in the field of life sciences.
CD4 antibody (Allophycocyanin-CY7)
CD4 antibody (Allophycocyanin) was raised in mouse using human CD4 as the immunoge.
Degré de pureté :Min. 95%ICAM2 antibody
ICAM2 antibody is a growth factor that plays a crucial role in various cellular processes. It has been shown to be involved in the regulation of immune responses, cell adhesion, and signal transduction. This antibody specifically targets ICAM2, an antigen expressed on the surface of cells.
PPIL2 antibody
PPIL2 antibody was raised using a synthetic peptide corresponding to a region with amino acids GRVVGGFDVLTAMENVESDPKTDRPKEEIRIDATTVFVDPYEEADAQIAQ
GJA1 antibody
The GJA1 antibody is a highly specific monoclonal antibody that targets oncostatin, a primary amino acid glycoprotein involved in various cellular processes. This antibody is widely used in Life Sciences research for studying the function and expression of GJA1. It can be utilized in various applications such as immunohistochemistry, Western blotting, and ELISA. The GJA1 antibody recognizes the cysteine disulfide region of the protein and exhibits high affinity and specificity. Researchers can also use polyclonal antibodies against GJA1 for further validation or as controls in their experiments. With its inhibitory factor properties, this antibody has potential applications in cancer research, specifically leukemia inhibitory factor studies. Its effectiveness has been demonstrated in human serum samples using electrode-based assays.
Goat anti Human IgG Fc
Human IgG Fc antibody was raised in goat using human IgG, Fc fragment as the immunogen.
BMPER antibody
BMPER antibody was raised using the C terminal of BMPER corresponding to a region with amino acids NGHKRDDLIGGDGNFKFDVDDFAESWRVESNEFCNRPQRKPVPELCQGTV
Degré de pureté :Min. 95%Beta tubulin antibody
The Beta tubulin antibody is a highly specific monoclonal antibody used in the field of Life Sciences. It is widely recognized for its ability to target and bind to beta tubulin, a protein involved in cell division and intracellular transport. This antibody plays a crucial role in various research applications, including the study of amyloid plaque formation, growth factor signaling pathways, antiangiogenic therapies, and the development of inhibitors such as taxol.
ARD1A antibody
ARD1A antibody was raised using a synthetic peptide corresponding to a region with amino acids VESKGNSPPSSGEACREEKGLAAEDSGGDSKDLSEVSETTESTDVKDSSE
CD147 antibody
The CD147 antibody is a versatile and potent steroid that has antidiabetic properties. It acts by inhibiting the activity of phosphatase, which plays a crucial role in regulating blood glucose levels. Additionally, this antibody can modulate chemokine activity, making it an effective tool for studying immune responses.
E2F4 antibody
The E2F4 antibody is a polyclonal antibody that has been shown to have apoptosis-inducing activity. It specifically targets the activated form of E2F4, an oncogenic kinase involved in cell proliferation and survival. This antibody can be used for immobilization in various life science applications, including research in the field of antibodies and growth factors. It is also effective as a monoclonal antibody against epidermal growth factor (EGF) inhibitors. The E2F4 antibody has been extensively studied and has shown high specificity and affinity for its target, making it a valuable tool for researchers in the field.
Calpain 10 antibody
Calpain 10 antibody was raised using the N terminal of CAPN10 corresponding to a region with amino acids MRAGRGATPARELFRDAAFPAADSSLFCDLSTPLAQFREDITWRRPQEIC
BTK antibody
The BTK antibody is a powerful tool in the field of Life Sciences. It targets the Bruton's tyrosine kinase (BTK), which plays a crucial role in various cellular processes. This antibody can be used for research purposes, such as studying the effects of BTK inhibition on cell signaling pathways and protein kinase activity.
Chicken anti Mouse IgG (H + L) (HRP)
This antibody reacts with heavy (gamma) chains on mouse IgG and light chains on all mouse immunoglobulins.Degré de pureté :Min. 95%Dengue NS1 antibody
The Dengue NS1 antibody is a cytotoxic monoclonal antibody that belongs to the class of antibodies known as anti-VEGF (vascular endothelial growth factor). It is widely used in the field of Life Sciences for various applications. This antibody has been shown to have nephrotoxic effects and can be used as an electrode-activated growth factor in endogenous hematopoietic cells. Additionally, it has acidic properties and may interact with insulin, fatty acid, and glucagon receptors. The Dengue NS1 antibody is highly specific and binds to markers expressed at high levels in dengue virus-infected cells, inhibiting viral replication and promoting immune response.
Goat anti Rat IgG (H + L) (HRP)
Goat anti-rat IgG (H+L) (HRP) was raised in goat using rat IgG whole molecule as the immunogen.Degré de pureté :Min. 95%Goat anti Mouse IgG + IgM (H + L)
Goat anti-mouse IgG/IgM (H+L) was raised in goat using murine IgG and IgM whole molecules as the immunogen.
Degré de pureté :Min. 95%MST4 antibody
The MST4 antibody is a chimeric protein that falls under the category of Life Sciences. It is a monoclonal antibody that specifically targets MST4, a protein involved in various cellular processes. This antibody has been extensively studied and characterized for its high specificity and affinity towards MST4.
SCNN1A antibody
The SCNN1A antibody is a monoclonal antibody used in Life Sciences research. It specifically targets the enteroendocrine cells and interferon production. This antibody has been extensively studied for its glycosylation patterns and its ability to induce caspase-9 activation, leading to cell lysis. Additionally, it has shown neutralizing effects on cytotoxic growth factors and anti-DNP antibodies. The viscosity of this antibody solution is optimized for easy handling and storage. Whether you're conducting experiments or performing assays, the SCNN1A antibody is a valuable tool in your research arsenal.
Dengue Virus Type 1 Envelope Antigen, Recombinant
Please enquire for more information about Dengue Virus Type 1 Envelope Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page
Degré de pureté :Min. 95%HBsAg Mouse Monoclonal Antibody
Please enquire for more information about HBsAg Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page
Degré de pureté :Min. 95%Denosumab
CAS :Monoclonal antibody against RANKL; anti-resorptive agent for osteoperosis treatment
Degré de pureté :(Sec-Hplc) Min. 95 Area-%Couleur et forme :Clear LiquidCA 125 antibody (biotin)
CA 125 antibody (biotin) was raised in mouse using affinity pure human CA 125 antigen as the immunogen.
