Anticorps primaires

Rabbit polyclonal DLG2 antibody

Rabbit polyclonal CUTL1 antibody

Affinity purified Rabbit polyclonal HSD17B1 antibody

The BCL2 antibody is a monoclonal antibody that specifically targets the BCL2 protein. This protein is involved in regulating cell death and has been implicated in various diseases, including cancer and neurodegenerative disorders. The BCL2 antibody is reactive and neutralizing, meaning it can bind to the BCL2 protein and prevent its activity.

The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an antituberculosis drug that falls under the category of rifamycins. It is highly effective in treating tuberculosis infections due to its bactericidal activity. This active compound works by binding to DNA-dependent RNA polymerase, inhibiting transcription and replication of bacteria. Its efficacy has been demonstrated through extensive research using the patch-clamp technique on human erythrocytes.

The GSTA2 antibody is a highly versatile product that plays a crucial role in various biological processes. It acts as a growth factor and chemokine, promoting cell proliferation and migration. This polyclonal antibody is specifically designed to target glutamate, an important neurotransmitter involved in various physiological functions.

The Caspase 9 antibody is a polyclonal antibody that specifically targets the caspase-9 protein. This antibody has been shown to have neutralizing properties and can effectively inhibit the activity of caspase-9. Caspase-9 plays a crucial role in apoptosis, or programmed cell death, by initiating the cascade of events that lead to cell death. By targeting caspase-9, this antibody can help regulate cell growth and survival.

SNRP70 antibody was raised using a synthetic peptide corresponding to a region with amino acids YLPPLEKLPHEKHHNQPYCGIAPYIREFEDPRDAPPPTRAETREERMERK

Affinity purified Rabbit polyclonal HLADR beta antibody

CD4 antibody (Allophycocyanin) was raised in mouse using human CD4 as the immunoge.

Affinity purified Rabbit polyclonal PDE1A antibody

beta 2 Microglobulin antibody was raised using the N terminal of B2M corresponding to a region with amino acids MSRSVALAVLALLSLSGLEAIQRTPKIQVYSRHPAENGKSNFLNCYVSGF

Sheep polyclonal 17a Trenbolone antibody

Annexin A5 antibody was raised using the N terminal of ANXA5 corresponding to a region with amino acids SELTGKFEKLIVALMKPSRLYDAYELKHALKGAGTNEKVLTEIIASRTPE

EPHA2 antibody was raised in Rabbit using Human EPHA2 as the immunogen

GHITM antibody was raised in Rabbit using Human GHITM as the immunogen

Affinity purified Rabbit polyclonal Ankyrin repeat domain 45 antibody

Mouse monoclonal CD10 antibody (FITC)

Mouse monoclonal CD45R antibody (PE)

Affinity purified Rabbit polyclonal ORP1 antibody

Rabbit polyclonal COX5A antibody (FITC)

Rat monoclonal CD44 antibody (allophycocyanin)

Rabbit polyclonal PPP3CB antibody

IRF3 antibody was raised in Rabbit using Human IRF3 as the immunogen

CHD2 antibody was raised in Rabbit using Human CHD2 as the immunogen

The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug belonging to the class of rifamycins. It is highly effective in treating tuberculosis infections by inhibiting bacterial growth. This drug works by binding to DNA-dependent RNA polymerase, preventing transcription and replication. It has been extensively studied using advanced techniques like the patch-clamp technique on human erythrocytes. The active form of this drug undergoes various metabolic transformations, including hydrolysis, oxidation, reduction, or conjugation with glucuronic acid. Additionally, it specifically targets Mycobacterium tuberculosis strains and inhibits their cell growth in culture. Tilmicosin is a macrolide antibiotic widely used in veterinary medicine for treating respiratory disorders caused by bacteria such as Clostridium perfringens. By binding to the ribosomal subunit, Tilmicosin effectively inhibits bacterial growth. Studies have shown that Tilmicos

Mouse monoclonal ZFAND2B antibody

The SERPINF2 antibody is a highly effective neutralizing agent that has been extensively studied in various scientific fields, including Life Sciences. It is a monoclonal antibody that has shown promising results in inhibiting the activity of SERPINF2, a protein involved in adipose tissue regulation. Through electrochemical impedance spectroscopy, it has been demonstrated that this antibody effectively binds to SERPINF2 and prevents its interaction with other molecules in the reaction solution.

C5AR1 antibody was raised in Rabbit using Human C5AR1 as the immunogen

The CRYAB antibody is a powerful tool used in life sciences research. It is a monoclonal antibody that specifically targets the CRYAB protein, also known as alpha-crystallin B chain. This protein plays a crucial role in various cellular processes, including cytoprotection, chaperone activity, and regulation of apoptosis.

Mouse monoclonal EPSP synthase antibody

UCHL5IP antibody was raised using the middle region of UCHL5IP corresponding to a region with amino acids LLDTIRSLTIGCSSCSSLMEHFEDTREKNEALLGELFSSPHLQMLLNPEC

Mouse monoclonal C1orf50 antibody

The PDIA3 antibody is a highly specialized protein that plays a crucial role in various biological processes. It acts as a growth factor, neutralizing cytotoxic effects, and regulating chemokine activity. This antibody is specifically designed to target and bind to PDIA3, inhibiting its function and preventing the progression of certain diseases.

The Cyclin D1 antibody is a globulin-based neutralizing antibody that specifically targets Cyclin D1, a protein involved in cell cycle regulation. This antibody has been extensively studied and proven to effectively inhibit the activity of Cyclin D1, making it a valuable tool for research purposes.

The COL1A2 antibody is a powerful tool in Life Sciences research. This antibody has inhibitory properties and can be used in various applications such as insulin immunoassays and the study of liver microsomes. It belongs to the class of Polyclonal Antibodies, which are highly specific and versatile. The COL1A2 antibody can be used to detect and quantify interferon, TGF-β1, and other autoantibodies in samples. It specifically targets nuclear tyrosine residues that are activated during cellular processes. Researchers rely on this monoclonal antibody for its exceptional sensitivity and reliability in their experiments.

Rabbit polyclonal PLCL2 antibody

The MMP16 antibody is a highly effective substance used in Life Sciences research. It is a monoclonal antibody that specifically targets the matrix metalloproteinase 16 (MMP16), also known as MT3-MMP. This antibody has been extensively studied and proven to be highly specific and sensitive in detecting MMP16 expression in various tissues and cell types.

KLHL31 antibody was raised using a synthetic peptide corresponding to a region with amino acids TPRGWHCAVTLSDRVYVMGGSQLGPRGERVDVLTVECYSPATGQWSYAAP

Affinity purified Rabbit polyclonal BXDC1 antibody

The Citrate Synthetase Antibody is a powerful tool used in Life Sciences research. This antibody specifically targets and binds to citrate synthetase, an enzyme involved in the Krebs cycle. By binding to this enzyme, the antibody allows for the detection and analysis of citrate synthetase levels in various biological samples.

ARL3 antibody was raised in rabbit using the N terminal of ARL3 as the immunogen

Rabbit polyclonal GRM7 antibody (Ser862)

Rabbit polyclonal RANBP3L antibody

WDR23 antibody was raised using the N terminal of WDR23 corresponding to a region with amino acids GSRNSSSAGSGSGDPSEGLPRRGAGLRRSEEEEEEDEDVDLAQVLAYLLR

Donkey anti-sheep IgG (H + L) (FITC) was raised in donkey using sheep IgG (H&L) as the immunogen.

The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections due to its potent bactericidal activity. This active compound works by binding to DNA-dependent RNA polymerase, inhibiting transcription and replication of bacteria. Extensive research has demonstrated its high efficacy through various techniques such as patch-clamp technique on human erythrocytes. The drug undergoes several metabolic transformations including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains, hindering cell growth in culture.

The Annexin A3 antibody is an essential antibody-drug that plays a crucial role in various biological processes. It specifically targets and binds to Annexin A3, a protein involved in glucagon receptor binding and antigen presentation. This antibody is available in both polyclonal and monoclonal forms, offering versatility for different research applications.

Rabbit polyclonal CD19 antibody (Tyr531)

Rabbit polyclonal PLD1 antibody (Ser561)

HPSE antibody was raised in rabbit using the N terminal of HPSE as the immunogen

The RAD18 antibody is a monoclonal antibody used in Life Sciences research. It specifically targets the chemokine receptor RAD18, which is involved in the immune response. This antibody can be used for various applications, such as immunoassays and neutralizing experiments. The RAD18 antibody is a chimeric protein composed of human immunoglobulin and can effectively bind to RAD18 glycoprotein. It has been shown to activate interferon and steroid signaling pathways, making it a valuable tool for studying immune responses and related diseases. With its high specificity and potency, the RAD18 antibody is an essential component in any research involving chemokines and their interactions with the immune system.

The HSPA9 antibody is a highly specialized product in the field of Life Sciences. It is an antibody that specifically targets HSPA9, also known as heat shock 70kDa protein 9. This protein plays a crucial role in various cellular processes, including cell survival and apoptosis.

Rabbit polyclonal RAB1B antibody

Rabbit polyclonal PSMG2 antibody

Mouse monoclonal NSMCE2 antibody

Rabbit polyclonal MAP2K1 antibody (Thr292)

Fibronectin antibody was raised in rabbit using fibronectin purified from human plasma as the immunogen.

Mycoplasma pneumoniae antibody is a product used in Life Sciences research to study protein-protein interactions. It is a monoclonal antibody that specifically targets and binds to Mycoplasma pneumoniae, a bacterium known to cause respiratory infections. The antibody can be used in various applications such as immunohistochemical detection, fluorescence immunochromatography, and polymerase chain reactions. It is highly specific and sensitive, making it an ideal tool for detecting the presence of Mycoplasma pneumoniae in samples such as human serum or cell cultures. This antibody can also be used to study the role of Mycoplasma pneumoniae in autoimmune diseases by investigating the presence of autoantibodies. Its high affinity for Mycoplasma pneumoniae antigens ensures accurate and reliable results in research experiments.

Rabbit polyclonal NDUFV2 antibody (biotin)

Affinity purified Rabbit polyclonal Protease Inhibitor 15 antibody

The SYT1 antibody is a highly effective polyclonal antibody that targets angptl3, a glycoprotein involved in various biological processes. This antibody can be used in chromatographic techniques for protein purification and immobilization, making it an essential tool in life sciences research. Additionally, the SYT1 antibody has neutralizing properties against inhibitors of growth factors, such as collagen, making it a valuable asset in cytotoxic studies. Whether you're conducting experiments or developing therapeutic strategies, the SYT1 antibody is a reliable choice for your research needs.

Rabbit polyclonal ADORA2B antibody

Rabbit polyclonal WBP11 antibody

INSC antibody was raised in Rabbit using Human INSC as the immunogen

CD70 antibody was raised in rabbit using the N terminal of CD70 as the immunogen

MTCH2 antibody was raised using a synthetic peptide corresponding to a region with amino acids ADAASQVLLGSGLTILSQPLMYVKVLIQVGYEPLPPTIGRNIFGRQVCQL

Rabbit polyclonal RPH3A antibody (ser234)

Rabbit polyclonal PIP5K3 antibody

Goat anti-rat IgG (Fab'2) (Rhodamine) was raised in goat using rat IgG F(ab')2 fragment as the immunogen.

Affinity purified Rabbit polyclonal CAPZB antibody

The VAV1 antibody is a highly specialized polyclonal antibody that targets the VAV1 protein. This protein plays a crucial role in endothelial growth and has been implicated in various biological processes. The VAV1 antibody is available as both polyclonal and monoclonal antibodies, allowing for versatile applications in life sciences research.

Affinity purified Rabbit polyclonal Fibulin 2 antibody

CLDN18 antibody was raised in Rabbit using Human CLDN18 as the immunogen

The LBP antibody is a monoclonal antibody that targets sumoylation, interleukins, and inhibitors. It is widely used in the field of Life Sciences for various applications. This antibody specifically recognizes and binds to tyrosine residues on proteins, including interferon-gamma and growth factors. It can be used for immunohistochemistry, western blotting, and other protein detection methods. The LBP antibody is also available as polyclonal antibodies and recombinant proteins for different research needs. With its high specificity and sensitivity, this antibody is an essential tool for studying protein interactions, signal transduction pathways, and diseases such as alpha-synuclein-related disorders.

Mouse monoclonal CD105 antibody (allophycocyanin)

Somatostatin antibody was raised in sheep using somatostatin conjugated to carrier protein as the immunogen.

Please enquire for more information about HBsAg Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page

Please enquire for more information about Dengue Virus Type 1 Envelope Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page

Monoclonal antibody against RANKL; anti-resorptive agent for osteoperosis treatment

CA 125 antibody (biotin) was raised in mouse using affinity pure human CA 125 antigen as the immunogen.

Cortisol antibody was raised in mouse using cortisol-3 BSA as the immunogen.