Anticorps primaires
Les anticorps primaires sont des immunoglobulines qui se lient spécifiquement à un antigène d'intérêt, permettant la détection et la quantification de protéines, peptides ou autres biomolécules. Ces anticorps sont des outils essentiels dans de nombreuses applications, notamment le Western blot, l'immunohistochimie et l'ELISA. Chez CymitQuimica, nous proposons une vaste sélection d'anticorps primaires de haute qualité, offrant spécificité et sensibilité pour divers besoins de recherche, notamment en cancérologie, immunologie et biologie cellulaire.
Sous-catégories appartenant à la catégorie "Anticorps primaires"
- Anticorps pour la recherche sur le cancer(3.721 produits)
- Anticorps cardio-vasculaires(2 produits)
- Biologie du développement(764 produits)
- Anticorps relatifs à l’épigénétique(162 produits)
- Anticorps d'immunologie(2.585 produits)
- Anticorps du métabolisme(286 produits)
- Anticorps de microbiologie(741 produits)
- Transduction du signal(2.765 produits)
- Tags & Marqueurs cellulaires(34 produits)
Affichez 1 plus de sous-catégories
75562 produits trouvés pour "Anticorps primaires"
Trier par
Degré de pureté (%)
0
100
|
0
|
50
|
90
|
95
|
100
SHC1 antibody
SHC1 antibody was raised in rabbit using the C terminal of SHC1 as the immunogenDegré de pureté :Min. 95%MPZL1 antibody
MPZL1 antibody was raised using the middle region of MPZL1 corresponding to a region with amino acids ISWAGDLDKKDASINIENMQFIHNGTYICDVKNPPDIVVQPGHIRLYVVE
Degré de pureté :Min. 95%BMP2 antibody
BMP2 antibody was raised in rabbit using highly pure human recombinant human BMP-2 as the immunogen.Degré de pureté :Min. 95%Jmjd8 antibody
Jmjd8 antibody was raised in rabbit using the C terminal of Jmjd8 as the immunogenDegré de pureté :Min. 95%PIK3R1 antibody
PIK3R1 antibody was raised in rabbit using the C terminal of PIK3R1 as the immunogenDegré de pureté :Min. 95%Lysozyme antibody (Prediluted for IHC)
Rabbit polyclonal Lysozyme antibody (Prediluted for IHC)Degré de pureté :Min. 95%UNC5A antibody
UNC5A antibody was raised using a synthetic peptide corresponding to a region with amino acids VYCRKKEGLDSDVADSSILTSGFQPVSIKPSKADNPHLLTIQPDLSTTTTDegré de pureté :Min. 95%DHODH antibody
DHODH antibody was raised using the N terminal of DHODH corresponding to a region with amino acids RFYAEHLMPTLQGLLDPESAHRLAVRFTSLGLLPRARFQDSDMLEVRVLGDegré de pureté :Min. 95%TPTE antibody
TPTE antibody was raised using the middle region of TPTE corresponding to a region with amino acids YFAQVKHLYNWNLPPRRILFIKHFIIYSIPRYVRDLKIQIEMEKKVVFSTDegré de pureté :Min. 95%SH2D3C antibody
SH2D3C antibody was raised using the N terminal of SH2D3C corresponding to a region with amino acids AGSDYVKFSKEKYILDSSPEKLHKELEEELKLSSTDLRSHAWYHGRIPREDegré de pureté :Min. 95%IGSF1 antibody
IGSF1 antibody was raised using the middle region of IGSF1 corresponding to a region with amino acids PRLRTRGSETDGRDQTIALEECNQEGEPGTPANSPSSTSQRISVELPVPIDegré de pureté :Min. 95%ZNF587 antibody
ZNF587 antibody was raised in rabbit using the middle region of ZNF587 as the immunogenDegré de pureté :Min. 95%Mitofusin 2 antibody
Mitofusin 2 antibody was raised using the C terminal of MFN2 corresponding to a region with amino acids LEQEIAAMNKKIEVLDSLQSKAKLLRNKAGWLDSELNMFTHQYLQPSRDegré de pureté :Min. 95%METT10D antibody
METT10D antibody was raised in rabbit using the N terminal of METT10D as the immunogenDegré de pureté :Min. 95%TRPC6 antibody
TRPC6 antibody was raised using the N terminal of TRPC6 corresponding to a region with amino acids MSQSPAFGPRRGSSPRGAAGAAARRNESQDYLLMDSELGEDGCPQAPLPCDegré de pureté :Min. 95%PCSK2 antibody
PCSK2 antibody was raised in rabbit using the middle region of PCSK2 as the immunogenDegré de pureté :Min. 95%Tetraspanin 2 antibody
Tetraspanin 2 antibody was raised using the middle region of TSPAN2 corresponding to a region with amino acids FAFIGKGVAIRHVQTMYEEAYNDYLKDRGKGNGTLITFHSTFQCCGKESSDegré de pureté :Min. 95%Thrombopoietin antibody
Thrombopoietin antibody was raised using a synthetic peptide corresponding to a region with amino acids NLQPGYSPSPTHPPTGQYTLFPLPPTLPTPVVQLHPLLPDPSAPTPTPTSDegré de pureté :Min. 95%RFXB antibody
RFXB antibody was raised in rabbit using residues 18-31 [ASELGDPEDPGEEAC] of the RFX-B protein as the immunogen.Degré de pureté :Min. 95%Factor X antibody
Factor X antibody was raised using the C terminal of F10 corresponding to a region with amino acids STLMTQKTGIVSGFGRTHEKGRQSTRLKMLEVPYVDRNSCKLSSSFIITQDegré de pureté :Min. 95%ZNF566 antibody
ZNF566 antibody was raised in rabbit using the middle region of ZNF566 as the immunogenDegré de pureté :Min. 95%P4HB antibody
P4HB antibody was raised using the N terminal of P4HB corresponding to a region with amino acids TIKFFRNGDTASPKEYTAGREADDIVNWLKKRTGPAATTLPDGAAAESLVDegré de pureté :Min. 95%Abcc2 antibody
Abcc2 antibody was raised in rabbit using the middle region of Abcc2 as the immunogenDegré de pureté :Min. 95%PA2G4 antibody
PA2G4 antibody was raised in rabbit using the C terminal of PA2G4 as the immunogenDegré de pureté :Min. 95%Angel1 antibody
Angel1 antibody was raised in rabbit using the C terminal of Angel1 as the immunogen
Degré de pureté :Min. 95%Vps45 antibody
Vps45 antibody was raised in rabbit using the C terminal of Vps45 as the immunogenDegré de pureté :Min. 95%Collagen Type VI Alpha 1 antibody
Collagen Type VI Alpha 1 antibody was raised using the middle region of COL6A1 corresponding to a region with amino acids ADITILLDGSASVGSHNFDTTKRFAKRLAERFLTAGRTDPAHDVRVAVVQ
Degré de pureté :Min. 95%RGS3 antibody
RGS3 antibody was raised using the C terminal of RGS3 corresponding to a region with amino acids KDNLQSVTRGCFDLAQKRIFGLMEKDSYPRFLRSDLYLDLINQKKMSPPLDegré de pureté :Min. 95%UCHL1 antibody
UCHL1 antibody was raised in rabbit using the C terminal of UCHL1 as the immunogenDegré de pureté :Min. 95%CLN8 antibody
CLN8 antibody was raised using a synthetic peptide corresponding to a region with amino acids VFGVQSTAAGLWALLGDPVLHADKARGQQNWCWFHITTATGFFCFENVAVDegré de pureté :Min. 95%NKIRAS2 antibody
NKIRAS2 antibody was raised using the middle region of NKIRAS2 corresponding to a region with amino acids KKEVTIVVLGNKCDLQEQRRVDPDVAQHWAKSEKVKLWEVSVADRRSLLEDegré de pureté :Min. 95%SCN3B antibody
SCN3B antibody was raised using the N terminal of SCN3B corresponding to a region with amino acids RPEGGKDFLIYEYRNGHQEVESPFQGRLQWNGSKDLQDVSITVLNVTLNDDegré de pureté :Min. 95%FGG antibody
FGG antibody was raised using the middle region of FGG corresponding to a region with amino acids GWTVFQKRLDGSVDFKKNWIQYKEGFGHLSPTGTTEFWLGNEKIHLISTQDegré de pureté :Min. 95%LEC antibody
LEC antibody was raised in goat using highly pure recombinant human LEC as the immunogen.Degré de pureté :Min. 95%MDM2 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections due to its bactericidal activity. This active compound works by binding to DNA-dependent RNA polymerase, preventing transcription and replication, thus inhibiting bacterial growth. Extensive research has shown its high efficacy through various techniques such as patch-clamp technique on human erythrocytes. Metabolically, it undergoes hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets Mycobacterium tuberculosis strains and inhibits cell growth in culture.Degré de pureté :Min. 95%WNT5B antibody
WNT5B antibody was raised using the middle region of WNT5B corresponding to a region with amino acids YCLRNESTGSLGTQGRLCNKTSEGMDGCELMCCGRGYNQFKSVQVERCHCDegré de pureté :Min. 95%STK38 antibody
STK38 antibody was raised using the C terminal of STK38 corresponding to a region with amino acids IGAPGVEEIKSNSFFEGVDWEHIRERPAAISIEIKSIDDTSNFDEFPESDDegré de pureté :Min. 95%HEPACAM antibody
HEPACAM antibody was raised using the N terminal of HEPACAM corresponding to a region with amino acids LLLSDLQLADEGTYEVEISITDDTFTGEKTINLTVDVPISRPQVLVASTTDegré de pureté :Min. 95%TBK1 antibody
TBK1 antibody was raised using the N terminal of TBK1 corresponding to a region with amino acids EEETTTRHKVLIMEFCPCGSLYTVLEEPSNAYGLPESEFLIVLRDVVGGM
Degré de pureté :Min. 95%LONRF2 antibody
LONRF2 antibody was raised using the middle region of LONRF2 corresponding to a region with amino acids FGMCLSAEHAGLSEYGCMLEIKDVRTFPDGSSVVDAIGISRFRVLSHRHRDegré de pureté :Min. 95%Gal3st4 antibody
Gal3st4 antibody was raised in rabbit using the C terminal of Gal3st4 as the immunogenDegré de pureté :Min. 95%IFN Alpha 7 antibody
IFN Alpha 7 antibody was raised using the N terminal of IFNA7 corresponding to a region with amino acids RALILLAQMGRISPFSCLKDRHEFRFPEEEFDGHQFQKTQAISVLHEMIQ
Degré de pureté :Min. 95%Gm527 antibody
Gm527 antibody was raised in rabbit using the C terminal of Gm527 as the immunogenDegré de pureté :Min. 95%PLUNC antibody
PLUNC antibody was raised using the middle region of PLUNC corresponding to a region with amino acids GLNNIIDIKVTDPQLLELGLVQSPDGHRLYVTIPLGIKLQVNTPLVGASLDegré de pureté :Min. 95%Septin 11 antibody
Septin 11 antibody was raised using the N terminal of 40432 corresponding to a region with amino acids MAVAVGRPSNEELRNLSLSGHVGFDSLPDQLVNKSTSQGFCFNILCVGETDegré de pureté :Min. 95%CRMP1 antibody
CRMP1 antibody was raised using the C terminal of CRMP1 corresponding to a region with amino acids SSPSKHQPPPIRNLHQSNFSLSGAQIDDNNPRRTGHRIVAPPGGRSNITS
Degré de pureté :Min. 95%Cytokeratin AE1 antibody (Prediluted for IHC)
Mouse monoclonal Cytokeratin AE1 antibody (Prediluted for IHC)Degré de pureté :Min. 95%ABCG5 antibody
ABCG5 antibody was raised using a synthetic peptide corresponding to a region with amino acids CGYPCPEHSNPFDFYMDLTSVDTQSKEREIETSKRVQMIESAYKKSAICH
Degré de pureté :Min. 95%SLC14A1 antibody
SLC14A1 antibody was raised using the C terminal of SLC14A1 corresponding to a region with amino acids LSSPLMCLHAAIGSLLGIAAGLSLSAPFENIYFGLWGFNSSLACIAMGGMDegré de pureté :Min. 95%Smarcd3 antibody
Smarcd3 antibody was raised in rabbit using the C terminal of Smarcd3 as the immunogenDegré de pureté :Min. 95%Fibromodulin antibody
Fibromodulin antibody was raised using the N terminal of FMOD corresponding to a region with amino acids VYFQNNQITSIQEGVFDNATGLLWIALHGNQITSDKVGRKVFSKLRHLERDegré de pureté :Min. 95%Adenovirus antibody
Adenovirus antibody was raised in rabbit using residues 255-264 [CYYKASDGAL] of the fiber knob protein of Ad 3 as the immunogen.Degré de pureté :Min. 95%Atg12 antibody
Atg12 antibody was raised in rabbit using the C terminal of Atg12 as the immunogen
Degré de pureté :Min. 95%TIE2 antibody
TIE2 antibody was raised in rabbit using an 18 amino acid peptide from human TIE2 as the immunogen.Degré de pureté :Min. 95%TBL2 antibody
TBL2 antibody was raised using a synthetic peptide corresponding to a region with amino acids RSGRPACQKANGFPPDKSSGSKKQKQYQRIRKEKPQQHNFTHRLLAAALKDegré de pureté :Min. 95%PDCD7 antibody
PDCD7 antibody was raised using the middle region of PDCD7 corresponding to a region with amino acids YLQAEHSLPALIQIRHDWDQYLVPSDHPKGNFVPQGWVLPPLPSNDIWATDegré de pureté :Min. 95%CHP antibody
CHP antibody was raised in rabbit using the N terminal of CHP as the immunogenDegré de pureté :Min. 95%Ectodysplasin A Receptor antibody
Ectodysplasin A Receptor antibody was raised using the middle region of EDAR corresponding to a region with amino acids PAPDKQGSPELCLLSLVHLAREKSATSNKSAGIQSRRKKILDVYANVCGVDegré de pureté :Min. 95%Neurturin antibody
Neurturin antibody was raised in rabbit using highly pure recombinant human neurturin as the immunogen.Degré de pureté :Min. 95%C20ORF116 antibody
C20ORF116 antibody was raised using the N terminal Of C20Orf116 corresponding to a region with amino acids PLHNEELAGAGRVAQPGPLEPEEPRAGGRPRRRRDLGSRLQAQRRAQRVADegré de pureté :Min. 95%MAPK13 antibody
MAPK13 antibody was raised using the middle region of MAPK13 corresponding to a region with amino acids KMLELDVDKRLTAAQALTHPFFEPFRDPEEETEAQQPFDDSLEHEKLTVD
Degré de pureté :Min. 95%USP17L2 antibody
USP17L2 antibody was raised in rabbit using the middle region of USP17L2 as the immunogen
Degré de pureté :Min. 95%CEBPZ antibody
CEBPZ antibody was raised in rabbit using the middle region of CEBPZ as the immunogenDegré de pureté :Min. 95%PDK1 antibody
PDK1 antibody was raised using the middle region of PDK1 corresponding to a region with amino acids ATMEHHANRGVYPPIQVHVTLGNEDLTVKMSDRGGGVPLRKIDRLFNYMY
Degré de pureté :Min. 95%RMI1 antibody
RMI1 antibody was raised using a synthetic peptide corresponding to a region with amino acids DGILEIPKGELNGFYALQINSLVDVSQPAYSQIQKLRGKNTTNDLVTAEA
Degré de pureté :Min. 95%SLC37A4 antibody
SLC37A4 antibody was raised using a synthetic peptide corresponding to a region with amino acids VSFLCLLLIHNEPADVGLRNLDPMPSEGKKGSLKEESTLQELLLSPYLWVDegré de pureté :Min. 95%ZNF710 antibody
ZNF710 antibody was raised in rabbit using the N terminal of ZNF710 as the immunogenDegré de pureté :Min. 95%IFN gamma antibody
IFN Gamma antibody was raised in rabbit using highly pure recombinant murine IFN-gamma as the immunogen.Degré de pureté :Min. 95%EPHX1 antibody
EPHX1 antibody was raised using a synthetic peptide corresponding to a region with amino acids CPSIPGYGFSEASSKKGFNSVATARIFYKLMLRLGFQEFYIQGGDWGSLI
Degré de pureté :Min. 95%TSC2 antibody
The TSC2 antibody is a highly effective growth factor that plays a crucial role in various Life Sciences applications. It has been extensively studied for its ability to regulate osteopontin and e-cadherin expression, making it an invaluable tool in research and experimentation. This polyclonal antibody offers exceptional hybridization capabilities, allowing for accurate detection and analysis of target proteins. Additionally, the TSC2 antibody has shown promising results in inhibiting angptl3 and anti-cd33 activity, further expanding its potential applications. With its specificity towards e-cadherin and β-catenin, this monoclonal antibody provides precise targeting for adipose-related studies. Whether you're conducting basic research or developing therapeutic interventions, the TSC2 antibody is an essential tool for any scientist looking to delve into the intricacies of cellular signaling pathways and protein interactions.Degré de pureté :Min. 95%GRO antibody
GRO antibody was raised in rabbit using highly pure recombinant human GRO/MGSA as the immunogen.Degré de pureté :Min. 95%TIMP3 antibody
TIMP3 antibody was raised in rabbit using the N terminal of TIMP3 as the immunogenDegré de pureté :Min. 95%ICMT antibody
ICMT antibody was raised using the middle region of ICMT corresponding to a region with amino acids GSNFNHVVQNEKSDTHTLVTSGVYAWFRHPSYVGWFYWSIGTQVMLCNPIDegré de pureté :Min. 95%MSH4 antibody
MSH4 antibody was raised using a synthetic peptide corresponding to a region with amino acids EITTQITRQILQNQRSTPEMERQRAVYHLATRLVQTARNSQLDPDSLRIYDegré de pureté :Min. 95%MLH1 antibody
MLH1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MIENCLDAKSTSIQVIVKEGGLKLIQIQDNGTGIRKEDLDIVCERFTTSKDegré de pureté :Min. 95%Aurora A antibody
The Aurora A antibody is a highly effective monoclonal antibody that is used for various applications in research and diagnostics. This antibody specifically targets and neutralizes the Aurora A kinase, which plays a crucial role in cell division and mitosis. By inhibiting the activity of Aurora A, this antibody can effectively block cell division and proliferation.Degré de pureté :Min. 95%DNAJC25 antibody
DNAJC25 antibody was raised using a synthetic peptide corresponding to a region with amino acids RDEEENIIKNIIKSKIDIKGGYQKPQICDLLLFQIILAPFHLCSYIVWYCDegré de pureté :Min. 95%RNASEH2A antibody
RNASEH2A antibody was raised using the C terminal of RNASEH2A corresponding to a region with amino acids EKEAEDVIWEDSASENQEGLRKITSYFLNEGSQARPRSSHRYFLERGLESDegré de pureté :Min. 95%LRP8 antibody
LRP8 antibody was raised using the middle region of LRP8 corresponding to a region with amino acids ATVDGGRRRTLFSRNLSEPRAIAVDPLRGFMYWSDWGDQAKIEKSGLNGV
Degré de pureté :Min. 95%RTN1 antibody
RTN1 antibody was raised using the middle region of RTN1 corresponding to a region with amino acids MAVVSMFTLPVVYVKHQAQIDQYLGLVRTHINAVVAKIQAKIPGAKRHAEDegré de pureté :Min. 95%alpha 1 Antitrypsin antibody (Prediluted for IHC)
Rabbit polyclonal alpha 1 Antitrypsin antibody (Prediluted for IHC)Degré de pureté :Min. 95%Kidins220 antibody
Kidins220 antibody was raised in rabbit using residues 1747-1762 [ASSESTGFGEERESIL] of the human 220kDa Kidins220 protein as the immunogen.Degré de pureté :Min. 95%IKZF2 antibody
IKZF2 antibody was raised in rabbit using the middle region of IKZF2 as the immunogen
Degré de pureté :Min. 95%PLCD1 antibody
PLCD1 antibody was raised using the N terminal of PLCD1 corresponding to a region with amino acids HWIHSCLRKADKNKDNKMSFKELQNFLKELNIQVDDSYARKIFRECDHSQ
Degré de pureté :Min. 95%FAM79B antibody
FAM79B antibody was raised in rabbit using the C terminal of FAM79B as the immunogenDegré de pureté :Min. 95%Leptin antibody
Leptin antibody was raised in rabbit using highly pure recombinant human leptin as the immunogen.Degré de pureté :Min. 95%TMEM115 antibody
TMEM115 antibody was raised using the N terminal of TMEM115 corresponding to a region with amino acids LLSFAVDTGCLAVTPGYLFPPNFWIWTLATHGLMEQHVWDVAISLTTVVVDegré de pureté :Min. 95%TCEAL2 antibody
TCEAL2 antibody was raised in rabbit using the N terminal of TCEAL2 as the immunogenDegré de pureté :Min. 95%GPR27 antibody
GPR27 antibody was raised using the middle region of GPR27 corresponding to a region with amino acids LVCAAWALALAAAFPPVLDGGGDDEDAPCALEQRPDGAPGALGFLLLLAVDegré de pureté :Min. 95%CLCA2 antibody
CLCA2 antibody was raised in rabbit using the C terminal of CLCA2 as the immunogenDegré de pureté :Min. 95%FURIN antibody
FURIN antibody was raised using a synthetic peptide corresponding to a region with amino acids RDVYQEPTDPKFPQQWYLSGVTQRDLNVKAAWAQGYTGHGIVVSILDDGIDegré de pureté :Min. 95%DKC1 antibody
DKC1 antibody was raised using the N terminal of DKC1 corresponding to a region with amino acids EFLIKPESKVAKLDTSQWPLLLKNFDKLNVRTTHYTPLACGSNPLKREIG
Degré de pureté :Min. 95%CDKL3 antibody
CDKL3 antibody is a monoclonal antibody that targets the CDKL3 protein, which is involved in various growth factor signaling pathways. It has been extensively studied in the field of Life Sciences and has shown promising results. The CDKL3 antibody specifically binds to the amino-terminal region of the CDKL3 protein and inhibits its activity.Degré de pureté :Min. 95%NDST4 antibody
NDST4 antibody was raised using a synthetic peptide corresponding to a region with amino acids YLFLLMHPSIISNLPSPKTFEEVQFFNGNNYHKGIDWYMDFFPTPSNTTSDegré de pureté :Min. 95%ZNF529 antibody
ZNF529 antibody was raised in rabbit using the N terminal of ZNF529 as the immunogen
Degré de pureté :Min. 95%RIPX antibody
RIPX antibody was raised in rabbit using the C terminal of RIPX as the immunogenDegré de pureté :Min. 95%TSTA3 antibody
TSTA3 antibody was raised using the N terminal of TSTA3 corresponding to a region with amino acids MGEPQGSMRILVTGGSGLVGKAIQKVVADGAGLPGEDWVFVSSKDADLTDDegré de pureté :Min. 95%
