Anticorps primaires

The IL24 antibody is a specific antibody that targets the protein Interleukin 24 (IL-24). IL-24 is a growth factor that plays a role in various biological processes, including cell proliferation and apoptosis. This antibody can be used for research purposes to study the function and regulation of IL-24.

Lipase antibody (Pancreatic) was raised using the C terminal of PNLIP corresponding to a region with amino acids SGKKVTGHILVSLFGNKGNSKQYEIFKGTLKPDSTHSNEFDSDVDVGDLQ

The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections and contains active compounds that exhibit bactericidal activity. By binding to DNA-dependent RNA polymerase, this drug inhibits bacterial growth, preventing transcription and replication. Its potency has been demonstrated using a patch-clamp technique on human erythrocytes. The active form of this drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed in Mycobacterium tuberculosis strains and inhibits cell growth in culture.

Rabbit polyclonal BLZF1 antibody

The CAP1 antibody is a highly specialized monoclonal antibody that targets the fibronectin protein. It specifically recognizes and binds to specific amino acid residues on fibronectin, inhibiting its function. This antibody has been extensively studied in the field of Life Sciences and has shown remarkable pharmacokinetic properties.

The ATF3 antibody is a protein that belongs to the family of necrosis factor-related apoptosis-inducing (TNF) monoclonal antibodies. It is commonly used in Life Sciences research as a tool to study the function and expression of ATF3, a transcription factor involved in cellular stress response. This monoclonal antibody specifically binds to human mitochondrial ATF3 and has been widely used in various applications such as immunohistochemistry, Western blotting, and flow cytometry. The ATF3 antibody recognizes an antigen located on the surface of cells and can be utilized for both diagnostic and therapeutic purposes. With its high specificity and cytotoxic properties, this glycoprotein is an essential tool for researchers working in the field of molecular biology and immunology. Additionally, polyclonal antibodies targeting ATF3 are also available for those who require a broader range of reactivity.

Affinity purified Rabbit polyclonal IRAK3 antibody

APOBEC3G antibody was raised in Rabbit using Human APOBEC3G as the immunogen

Annexin A3 antibody was raised using the N terminal of ANXA3 corresponding to a region with amino acids MASIWVGHRGTVRDYPDFSPSVDAEAIQKAIRGIGTDEKMLISILTERSN

PSME3 antibody was raised using the C terminal of PSME3 corresponding to a region with amino acids TVTEIDEKEYISLRLIISELRNQYVTLHDMILKNIEKIKRPRSSNAETLY

Rabbit polyclonal STXBP2 antibody

Loricrin antibody was raised using the N terminal of LOR corresponding to a region with amino acids GYSGGGCGGGSSGGGGGGGIGGCGGGSGGSVKYSGGGGSSGGGSGCFSSG

TNFRSF25 antibody was raised in rabbit using the middle region of TNFRSF25 as the immunogen

The FZD8 antibody is a diagnostic reagent that plays a crucial role in the field of Life Sciences. It is an antigen-specific antibody that specifically targets and binds to the FZD8 protein. This antibody is widely used in various research applications, including immunohistochemistry, western blotting, and flow cytometry.

Rabbit polyclonal SYT1 antibody (Ser309)

sRANKL antibody (biotin) was raised in goat using highly pure recombinant human sRANKL as the immunogen.

Affinity purified Rabbit polyclonal PSMC6 antibody

Rabbit polyclonal EDG2 antibody

Affinity purified Mouse polyclonal FABP2 antibody

ACSS1 antibody was raised in Rabbit using Human ACSS1 as the immunogen

VDAC1 antibody was raised using the C terminal of VDAC1 corresponding to a region with amino acids SAKVNNSSLIGLGYTQTLKPGIKLTLSALLDGKNVNAGGHKLGLGLEFQA

The BCAT1 antibody is a highly specialized antibody that plays a crucial role in various biological processes. It is commonly used in Life Sciences research and has proven to be effective in studying the receptor binding of certain substances. This antibody is particularly useful in the field of oncology, as it can help researchers understand the mechanisms behind cancer growth and potentially develop targeted therapies.

Affinity purified Rabbit polyclonal CMAS antibody

CCNH antibody was raised in Rabbit using Human CCNH as the immunogen

Affinity purified Rabbit polyclonal ABH1 antibody

NUDT6 antibody was raised in rabbit using the middle region of NUDT6 as the immunogen

TGFR3 antibody is a polyclonal antibody that specifically targets the TGFR3 protein. It is commonly used in life sciences research to study the role of TGFR3 in various cellular processes. This antibody can be used for applications such as immunohistochemistry, western blotting, and flow cytometry.

Amylase antibody is a polyclonal antibody that specifically targets and binds to amylase, an enzyme responsible for the breakdown of starch into sugars. This antibody has been widely used in life sciences research to study the role of amylase in various biological processes.

TH antibody was raised in rabbit using the n terminal of TH as the immunogen

Affinity purified Rabbit polyclonal TFEC antibody

The CLPP antibody is a monoclonal antibody that specifically targets the CLPP protein. This glycoprotein plays a crucial role in various biological processes and has been extensively studied in the field of Life Sciences. The CLPP antibody recognizes and binds to the histidine residues on the CLPP protein, allowing for accurate detection and analysis.

DUOXA1 antibody was raised in rabbit using the C terminal of DUOXA1 as the immunogen

Affinity purified Rabbit polyclonal DNA polymerase delta cat antibody

Affinity purified Rabbit polyclonal SART1 antibody

The RBP1 antibody is a monoclonal antibody that specifically targets the TGF-beta1 protein. It can be used in various research applications in Life Sciences, such as studying the effects of TGF-beta1 on cellular processes and signaling pathways. The RBP1 antibody has been shown to neutralize the activity of TGF-beta1, which plays a crucial role in cell growth, differentiation, and immune response regulation. Additionally, this antibody can be used in combination with other antibodies or drugs, such as imatinib or interferon, to investigate potential synergistic effects. Its high specificity and affinity make it an excellent tool for studying TGF-beta1-related mechanisms and developing therapeutic interventions.

ALDH1B1 antibody was raised in Rabbit using Human ALDH1B1 as the immunogen

Rabbit polyclonal 5HT1A antibody

NANOG antibody was raised in Rabbit using Human NANOG as the immunogen

Rabbit polyclonal SERC3 antibody

ATP6V1G3 antibody was raised in Rabbit using Human ATP6V1G3 as the immunogen

The Livin antibody is a powerful tool in Life Sciences research. It specifically targets mesothelin, a protein that is often overexpressed in various types of cancer. By binding to mesothelin, the Livin antibody can be used to detect and measure its presence in human serum samples. Studies have shown that high levels of mesothelin are associated with increased microvessel density and tumor growth, making it an important marker for cancer prognosis and treatment.

The purified Mouse IgG h+l can be utilized for ELISA, Western Blot and as a Blocking Agent. Please inquire for bulk pricing.

Rabbit polyclonal CDH10 antibody

Purified Polyclonal RPL28 antibody

Rabbit polyclonal Alpha enolase antibody (biotin)

The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections and contains active compounds with bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, which inhibits bacterial growth and prevents transcription and replication. Additionally, it has been extensively studied using the patch-clamp technique on human erythrocytes, demonstrating its high frequency of human activity. The active form of this drug undergoes various metabolic transformations such as hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. It also specifically binds to markers expressed in Mycobacterium tuberculosis strains and inhibits cell growth in culture.

NR5A1 antibody was raised using the middle region of NR5A1 corresponding to a region with amino acids SLHGPEPKGLAAGPPAGPLGDFGAPALPMAVPGAHGPLAGYLYPAFPGRA

IL27 antibody was raised in rabbit using the C terminal of IL27 as the immunogen

NDOR1 antibody was raised in Rabbit using Human NDOR1 as the immunogen

Affinity purified Rabbit polyclonal FAM122B antibody

Affinity purified Rabbit polyclonal BRE antibody

The SOCS3 antibody is a highly specific monoclonal antibody that has been developed for use in the field of life sciences. It is used to target and neutralize IL-17A, a cytokine involved in inflammatory responses. This specific antibody can be used in various applications, including as a therapeutic agent or as a research tool for studying IL-17A-mediated signaling pathways.

The Chlorpyrifos antibody is a growth factor that specifically targets messenger RNA (mRNA) molecules. It is a monoclonal antibody that is designed to detect and bind to contaminants, such as chlorpyrifos, in various samples. This antibody is widely used in the field of Life Sciences for applications such as immunoassays and polymerase chain reactions (PCR). The Chlorpyrifos antibody offers high specificity and sensitivity, making it an ideal choice for researchers and scientists working in environmental monitoring, agriculture, and toxicology. With its excellent chemical stability and long shelf life, this antibody ensures reliable results and consistent performance. Whether you need to detect chlorpyrifos residues or develop a medicament for exposure prevention, the Chlorpyrifos antibody is your go-to solution. Choose from our wide range of options, including gold nanoparticle-conjugated antibodies or polyclonal antibodies, to suit your specific research needs.

DPYS antibody was raised using the N terminal of DPYS corresponding to a region with amino acids VLDAAGKLVLPGGIDTHTHMQFPFMGSRSIDDFHQGTKAALSGGTTMIID

Please enquire for more information about HBsAg Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page

Monoclonal antibody against RANKL; anti-resorptive agent for osteoperosis treatment

Please enquire for more information about Dengue Virus Type 1 Envelope Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page

CA 125 antibody (biotin) was raised in mouse using affinity pure human CA 125 antigen as the immunogen.

Cortisol antibody was raised in mouse using cortisol-3 BSA as the immunogen.