Anticorps primaires

CHRNA9 antibody was raised in rabbit using the N terminal of CHRNA9 as the immunogen

The AQP1 antibody is a monoclonal antibody that targets the aquaporin-1 (AQP1) protein. Aquaporins are a family of water channel proteins that play a crucial role in regulating water transport across cell membranes. AQP1 is specifically expressed in endothelial cells, where it facilitates the movement of water and small solutes across blood vessels.

IFT74 antibody was raised in rabbit using the C terminal of IFT74 as the immunogen

Rabbit polyclonal IL1RA antibody

Affinity purified Rabbit polyclonal SHC4 antibody

ARHGDIG antibody was raised in Rabbit using Human ARHGDIG as the immunogen

Affinity purified Rabbit polyclonal HMMR antibody

TM9SF1 antibody was raised using the N terminal of TM9SF1 corresponding to a region with amino acids EGVTHYKAGDPVILYVNKVGPYHNPQETYHYYQLPVCCPEKIRHKSLSLG

The AVEN antibody is a highly specialized monoclonal antibody that targets specific molecules in the body. It is particularly effective in binding to β-catenin, collagen, anti-mesothelin, and urokinase plasminogen activator. This antibody is widely used in Life Sciences research for its ability to detect and inhibit the activity of these target molecules.

Affinity purified Rabbit polyclonal MYBPC2 antibody

MFAP3L antibody was raised using the N terminal of MFAP3L corresponding to a region with amino acids MHDSGLLNITKVSFSDRGKYTCVASNIYGTVNNTVTLRVIFTSGDMGVYY

GALNS antibody was raised in Rabbit using Human GALNS as the immunogen

AP1M1 antibody was raised in Rabbit using Human AP1M1 as the immunogen

Affinity purified Rabbit polyclonal XRCC2 antibody

Factor VIII antibody is a monoclonal antibody that targets sclerostin, an epidermal growth factor. It is commonly used in Life Sciences research as a tool to study the role of sclerostin in bone metabolism and growth. This antibody has been shown to be highly specific and effective in neutralizing the activity of sclerostin, leading to increased bone formation and density. Factor VIII antibody can also be used as a cytotoxic agent in certain applications, such as targeted therapy for cancer cells that express high levels of sclerostin. Additionally, this antibody can be conjugated to various biomaterials or used in combination with other antibodies for specific research purposes. Its unique properties make it a valuable tool for studying the effects of sclerostin on bone health and development.

Rabbit polyclonal ALPI antibody

The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections due to its bactericidal activity. This active compound works by binding to DNA-dependent RNA polymerase, which inhibits bacterial growth and prevents transcription and replication. Its potency has been demonstrated through various scientific techniques such as the patch-clamp technique on human erythrocytes. Metabolically, it undergoes hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed in Mycobacterium tuberculosis strains and inhibits their cell growth in culture.

IL10 antibody is a medicament that belongs to the class of antibodies. It is a protein complex that specifically targets and binds to IL10, a cytokine involved in immune regulation. IL10 antibody can be used as a therapeutic agent for various diseases characterized by excessive IL10 activity, such as autoimmune disorders and inflammatory conditions. This monoclonal antibody has been extensively studied in the field of Life Sciences and has shown promising results in preclinical and clinical trials. It has the ability to neutralize the effects of IL10, thereby reducing its immunosuppressive and anti-inflammatory properties. IL10 antibody is also being investigated for its potential antiviral activity and its ability to enhance the effectiveness of multidrug therapies.

SAAL1 antibody was raised using the middle region of SAAL1 corresponding to a region with amino acids EKLMLEWVRNGAAQPLDQPQEESEEQPVFRLVPCILEAAKQVRSENPEWL

6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an active compound used as an antituberculosis drug. It belongs to the class of rifamycins and is highly effective in treating tuberculosis infections. This powerful drug works by inhibiting bacterial growth through its bactericidal activity. By binding to DNA-dependent RNA polymerase, it prevents transcription and replication, effectively stopping the spread of the infection. Additionally, 6-Fluoro-3-indoxyl-beta-D-galactopyranoside has been extensively studied using advanced techniques such as transcription-quantitative polymerase chain and patch-clamp technique. Its metabolic transformations include hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. It specifically targets Mycobacterium tuberculosis strains and inhibits their cell growth in culture.

ERC2 antibody was raised in Rabbit using Human ERC2 as the immunogen

The FPR1 antibody is a highly specialized medicament used in Life Sciences research. It is a monoclonal antibody that specifically targets and binds to e-cadherin, a glycoprotein involved in cell adhesion. This colloidal antibody has been extensively studied for its inhibitory effects on e-cadherin expression and its potential as a therapeutic agent in various diseases.

Haptoglobin antibody is a monoclonal antibody that specifically targets haptoglobin, a human protein found in plasma. It is widely used in Life Sciences research to study the role of haptoglobin in various biological processes. Haptoglobin antibody has been shown to bind to haptoglobin expressed in human hepatocytes and inhibit its function. This antibody can also be used for immunohistochemistry and Western blotting to detect haptoglobin levels in human serum samples. Additionally, haptoglobin antibody has been used in studies investigating the interaction between haptoglobin and other molecules such as fatty acids, lectins, and transport proteins. Its specificity and high affinity make it a valuable tool for researchers studying the functions of haptoglobin and its polymorphic variants.

AFP antibody was raised in Rabbit using Human AFP as the immunogen

IL4 antibody is a glycoprotein that belongs to the class of monoclonal antibodies. It is commonly used in life sciences research and has various applications in the field. IL4 antibody can be used as a tool to study the role of interleukin-4 (IL-4) in immune responses and inflammation. It can also be used as an inhibitor to block the activity of IL-4, which is involved in anti-angiogenesis and other processes.

Affinity purified Rabbit polyclonal WNT10A antibody

VSIG4 antibody was raised using the N terminal of VSIG4 corresponding to a region with amino acids VPGDVSLQLSTLEMDDRSHYTCEVTWQTPDGNQVVRDKITELRVQKLSVS

The CtBP1 antibody is a highly specialized antibody that specifically targets and neutralizes CtBP1, a growth factor involved in various cellular processes. This antibody is widely used in Life Sciences research and has proven to be an invaluable tool for studying the function of CtBP1 in different biological systems.

The IL24 antibody is a specific antibody that targets the protein Interleukin 24 (IL-24). IL-24 is a growth factor that plays a role in various biological processes, including cell proliferation and apoptosis. This antibody can be used for research purposes to study the function and regulation of IL-24.

Lipase antibody (Pancreatic) was raised using the C terminal of PNLIP corresponding to a region with amino acids SGKKVTGHILVSLFGNKGNSKQYEIFKGTLKPDSTHSNEFDSDVDVGDLQ

The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections and contains active compounds that exhibit bactericidal activity. By binding to DNA-dependent RNA polymerase, this drug inhibits bacterial growth, preventing transcription and replication. Its potency has been demonstrated using a patch-clamp technique on human erythrocytes. The active form of this drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed in Mycobacterium tuberculosis strains and inhibits cell growth in culture.

Rabbit polyclonal BLZF1 antibody

The CAP1 antibody is a highly specialized monoclonal antibody that targets the fibronectin protein. It specifically recognizes and binds to specific amino acid residues on fibronectin, inhibiting its function. This antibody has been extensively studied in the field of Life Sciences and has shown remarkable pharmacokinetic properties.

The ATF3 antibody is a protein that belongs to the family of necrosis factor-related apoptosis-inducing (TNF) monoclonal antibodies. It is commonly used in Life Sciences research as a tool to study the function and expression of ATF3, a transcription factor involved in cellular stress response. This monoclonal antibody specifically binds to human mitochondrial ATF3 and has been widely used in various applications such as immunohistochemistry, Western blotting, and flow cytometry. The ATF3 antibody recognizes an antigen located on the surface of cells and can be utilized for both diagnostic and therapeutic purposes. With its high specificity and cytotoxic properties, this glycoprotein is an essential tool for researchers working in the field of molecular biology and immunology. Additionally, polyclonal antibodies targeting ATF3 are also available for those who require a broader range of reactivity.

Affinity purified Rabbit polyclonal IRAK3 antibody

APOBEC3G antibody was raised in Rabbit using Human APOBEC3G as the immunogen

Annexin A3 antibody was raised using the N terminal of ANXA3 corresponding to a region with amino acids MASIWVGHRGTVRDYPDFSPSVDAEAIQKAIRGIGTDEKMLISILTERSN

PSME3 antibody was raised using the C terminal of PSME3 corresponding to a region with amino acids TVTEIDEKEYISLRLIISELRNQYVTLHDMILKNIEKIKRPRSSNAETLY

Rabbit polyclonal STXBP2 antibody

Rabbit polyclonal MKNK1 antibody

Fascin antibody is a highly specific monoclonal antibody that targets fascin, a protein involved in cell migration and adhesion. It binds to histidine residues on the fascin molecule, inhibiting its function and preventing tumor metastasis. This antibody has been extensively studied in various research fields, including cancer biology and immunology. Fascin antibody can be used in experiments to detect fascin expression levels in human serum samples or tissue sections. Additionally, it has been shown to have cytotoxic effects on cancer cells and can be used as a therapeutic agent in cancer treatment. The use of this antibody has also been explored in autoimmune diseases, where autoantibodies targeting fascin have been identified. Overall, Fascin antibody is a valuable tool for researchers in the Life Sciences field who are studying cell migration, tumor metastasis, and autoimmunity.

The FMO2 antibody is a monoclonal antibody that has been developed for its potential use as a medicament in the field of Life Sciences. This antibody exhibits cytotoxic properties and has been shown to induce cell cytotoxicity in various studies. It specifically targets and binds to a growth factor known as phosphorylcholine, inhibiting its activity and preventing further cell growth.

FECH antibody was raised in Rabbit using Human FECH as the immunogen

Affinity purified Rabbit polyclonal LOC283129 antibody

Affinity purified Rabbit polyclonal ZFP 140 antibody

Affinity purified Mouse polyclonal FABP2 antibody

ACSS1 antibody was raised in Rabbit using Human ACSS1 as the immunogen

VDAC1 antibody was raised using the C terminal of VDAC1 corresponding to a region with amino acids SAKVNNSSLIGLGYTQTLKPGIKLTLSALLDGKNVNAGGHKLGLGLEFQA

The BCAT1 antibody is a highly specialized antibody that plays a crucial role in various biological processes. It is commonly used in Life Sciences research and has proven to be effective in studying the receptor binding of certain substances. This antibody is particularly useful in the field of oncology, as it can help researchers understand the mechanisms behind cancer growth and potentially develop targeted therapies.

Affinity purified Rabbit polyclonal CMAS antibody

CCNH antibody was raised in Rabbit using Human CCNH as the immunogen

Affinity purified Rabbit polyclonal ABH1 antibody

NUDT6 antibody was raised in rabbit using the middle region of NUDT6 as the immunogen

Rabbit polyclonal CACNG2 antibody

MTHFD2 antibody was raised using a synthetic peptide corresponding to a region with amino acids LPLPEHIDERRICNAVSPDKDVDGFHVINVGRMCLDQYSMLPATPWGVWE

Monoclonal antibody against RANKL; anti-resorptive agent for osteoperosis treatment

Please enquire for more information about HBsAg Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page

Please enquire for more information about Dengue Virus Type 1 Envelope Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page

CA 125 antibody (biotin) was raised in mouse using affinity pure human CA 125 antigen as the immunogen.

Cortisol antibody was raised in mouse using cortisol-3 BSA as the immunogen.