Anticorps primaires

Brachyury antibody was raised in rabbit using the internal sequence of the human Brachyury protein as the immunogen.

Rabbit polyclonal PECR antibody

PDIA4 antibody was raised using the N terminal of PDIA4 corresponding to a region with amino acids ENAIEDEEEEEEEDDDEEEDDLEVKEENGVLVLNDANFDNFVADKDTVLL

BTBD10 antibody was raised using a synthetic peptide corresponding to a region with amino acids AGRPHPYDGNSSDPENWDRKLHSRPRKLYKHSSTSSRIAKGGVDHTKMSL

TNFSF10 antibody was raised in rabbit using the N terminal of TNFSF10 as the immunogen

Affinity purified Rabbit polyclonal CBFA1 antibody

The BRCA2 antibody is a highly specific monoclonal antibody that is used in Life Sciences research. It specifically targets the BRCA2 protein, which is involved in DNA repair and maintenance of genomic stability. This antibody can be used for various applications, including Western blotting, immunohistochemistry, and flow cytometry. It has been shown to have high affinity and specificity for the BRCA2 protein, making it a valuable tool for studying its function and regulation. Additionally, this antibody does not cross-react with other proteins such as transferrin, alpha-fetoprotein, collagen, or lipoprotein lipase, ensuring accurate and reliable results. Whether you are studying DNA repair mechanisms or investigating the role of BRCA2 in cancer development, this BRCA2 antibody will provide you with the precise and reliable data you need for your research.

Rabbit polyclonal CKS1 antibody

Mouse monoclonal PYCRL antibody

CD4a antibody (FITC) was raised in mouse using CD4a as the immunogen.

Rabbit polyclonal PDHX antibody

Rabbit polyclonal IKK gamma antibody

The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections due to its bactericidal activity. This active compound works by binding to DNA-dependent RNA polymerase, which inhibits bacterial growth by preventing transcription and replication. Its efficacy has been demonstrated through extensive research using the patch-clamp technique on human erythrocytes. The drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits their cell growth in culture.

Affinity purified Rabbit polyclonal Cofilin 2 antibody

Rabbit polyclonal BTF3L3 antibody

The FSH antibody is a highly specialized immunohistochemistry tool used in the field of Life Sciences. It specifically targets the tumor necrosis factor-alpha (TNF-α) and acts as a kinase receptor growth factor. This polyclonal antibody plays a crucial role in binding proteins and cytotoxicity, particularly against tyrosine kinase receptors.

Purified Goat anti-human Eotaxin polyclonal antibody

KCTD13 antibody was raised using the N terminal of KCTD13 corresponding to a region with amino acids PGPAAYGLKPLTPNSKYVKLNVGGSLHYTTLRTLTGQDTMLKAMFSGRVE

CD45.2 antibody (Spectral Red) was raised in mouse using CD45.2 as the immunogen.

The FOXP1 antibody is a highly effective and versatile tool used in Life Sciences research. It is a polyclonal antibody that specifically targets the FOXP1 protein, which plays a crucial role in various cellular processes. This antibody binds to the nuclear-activated FOXP1 protein, allowing for its detection and analysis.

CD3 antibody (Allophycocyanin-CY7) was raised in mouse using the epsilon chain of CD3/T-cell antigen receptor complex as the immunogen.

C1R antibody is a polyclonal antibody that targets the C1R protein complex. It has neutralizing properties and can be used in various life science applications. This antibody has been shown to inhibit the activity of interferon, TNF-α, and interleukin-6. It can be used in research studies to investigate the role of C1R in different biological processes. The C1R antibody is highly specific and reliable, making it an essential tool for researchers working with biomolecules. Whether you are studying dopamine signaling or exploring the effects of haloperidol and droperidol, this antibody will provide accurate and reproducible results.

Goat anti-armenian hamster IgG (H + L) (biotin) was raised in goat using hamster IgG (H & L) as the immunogen.

The SGSH antibody is a highly specialized antibody that targets sulfatase, an enzyme involved in the breakdown of complex molecules called glycosaminoglycans (GAGs). This antibody specifically recognizes and binds to the sulfatase nucleotide-binding site, inhibiting its activity.

The EFEMP1 antibody is a cytotoxic monoclonal antibody that has neutralizing properties. It specifically targets alpha-fetoprotein, a protein that is often overexpressed in certain types of cancer cells. This antibody binds to the alpha-fetoprotein and inhibits its function, leading to cell death. The EFEMP1 antibody has been extensively studied in the field of life sciences and has shown promising results as a potential medicament for cancer treatment. Additionally, it has been found to interfere with collagen synthesis and inhibit the activity of growth factors, further contributing to its anti-cancer effects. This highly specialized antibody holds great potential in the development of targeted therapies for various types of cancers.

ERCC6 antibody was raised in mouse using recombinant Human Excision Repair Cross-Complementing Rodent Repair Deficiency, Complementation Group 6 (Ercc6)

alpha 1 Antiplasmin antibody was raised in sheep using human alpha 1 Antiplasmin purified from plasma as the immunogen.

Rabbit polyclonal TNFSF10 antibody (HRP)

Rabbit polyclonal SF3A3 antibody

RG9MTD2 antibody was raised using a synthetic peptide corresponding to a region with amino acids EDLIYLTSDSPNILKELDESKAYVIGGLVDHNHHKGLTYKQASDYGINHA

CD45.2 antibody (CY5) was raised in mouse using CD45.2 as the immunogen.

The K2 antibody is a highly effective nucleotide molecule that targets alpha-synuclein, a protein associated with neurodegenerative diseases such as Parkinson's and Alzheimer's. This anti-her2 antibody-drug conjugate specifically binds to the HER2 receptor, which is overexpressed in certain types of cancer cells. It works by inhibiting the epidermal growth factor signaling pathway, preventing the growth and proliferation of cancer cells.

FABP3 antibody was raised using a synthetic peptide corresponding to a region with amino acids NGDILTLKTHSTFKNTEISFKLGVEFDETTADDRKVKSIVTLDGGKLVHL

Affinity purified Rabbit polyclonal Complement C2 antibody

This antibody reacts with heavy chains on human IgA + IgG + IgM and light chains on all human immunoglobulins.

Ubiquilin 3 antibody was raised using the N terminal of UBQLN3 corresponding to a region with amino acids LMRQHVSVPEFVTQLIDDPFIPGLLSNTGLVRQLVLDNPHMQQLIQHNPE

COTL1 antibody was raised in Rabbit using Human COTL1 as the immunogen

TIP47 antibody was raised in guinea pig using synthetic peptide of TIP47 N-terminus as the immunogen.

Rabbit polyclonal IL13 antibody (biotin)

The SMAD2 antibody is a highly specialized biomolecule that plays a crucial role in the field of Life Sciences. This monoclonal antibody is designed to specifically target and neutralize SMAD2, a key protein involved in various cellular processes. It has been extensively studied for its potential applications in research and therapeutic settings.

Rab23 antibody was raised in rabbit using the middle region of Rab23 as the immunogen

Rabbit polyclonal IFN beta antibody (HRP)

GCLM antibody was raised in Rabbit using Human GCLM as the immunogen

PRSS21 antibody was raised in rabbit using the N terminal of PRSS21 as the immunogen

Purified Rabbit polyclonal PR1b antibody

FGF21 antibody was raised using the N terminal of FGF21 corresponding to a region with amino acids DSDETGFEHSGLWVSVLAGLLLGACQAHPIPDSSPLLQFGGQVRQRYLYT

The LHR antibody is a high-quality polyclonal antibody that specifically targets the luteinizing hormone receptor (LHR). It is widely used in various research fields, particularly in the life sciences. This antibody is highly specific and exhibits strong binding affinity to LHR, making it an excellent tool for studying the role of LHR in different biological processes.

The Lin28B antibody is an effective molecular inhibitor that has shown promising results as an anticancer agent. It specifically targets the Lin28B protein, a key regulator of cancer progression. By inhibiting the activity of this protein, the antibody can effectively inhibit tumor growth and metastasis. This antibody is a valuable tool in cancer research and can be used in various applications such as chemotherapy and molecular biology studies. With its high specificity and potency, the Lin28B antibody offers great potential for developing novel therapeutic strategies against cancer.

GSTP1 antibody was raised using the N terminal of GSTP1 corresponding to a region with amino acids TVETWQEGSLKASCLYGQLPKFQDGDLTLYQSNTILRHLGRTLGLYGKDQ

Monoclonal antibody against RANKL; anti-resorptive agent for osteoperosis treatment

Please enquire for more information about HBsAg Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page

Please enquire for more information about Dengue Virus Type 1 Envelope Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page

CA 125 antibody (biotin) was raised in mouse using affinity pure human CA 125 antigen as the immunogen.

Cortisol antibody was raised in mouse using cortisol-3 BSA as the immunogen.