Anticorps primaires
Sous-catégories appartenant à la catégorie "Anticorps primaires"
- Anticorps pour la recherche sur le cancer(3.721 produits)
- Anticorps cardio-vasculaires(2 produits)
- Biologie du développement(764 produits)
- Anticorps relatifs à l’épigénétique(162 produits)
- Anticorps d'immunologie(2.585 produits)
- Anticorps du métabolisme(286 produits)
- Anticorps de microbiologie(741 produits)
- Transduction du signal(2.765 produits)
- Tags & Marqueurs cellulaires(34 produits)
75562 produits trouvés pour "Anticorps primaires"
CD152 antibody (Azide Free)
CD152 antibody (Azide free) was raised in hamster using murine CD152/CTLA-4 as the immunogen.
Degré de pureté :Min. 95%Guinea Pig RBC antibody (Texas Red)
Guinea pig RBC antibody (Texas Red) was raised in rabbit using guinea pig erythrocytes as the immunogen.PKNOX1 antibody
The PKNOX1 antibody is a highly specialized monoclonal antibody that targets the PKNOX1 protein. This protein is involved in various cellular processes, including fibrinogen production, cell antigen presentation, and amyloid plaque formation. Additionally, PKNOX1 plays a crucial role as a growth factor and phosphatase regulator.
Goat anti Rat IgG (Fab'2) (FITC)
Goat anti-rat IgG (Fab'2) (FITC) was raised in goat using rat IgG F(c) fragment as the immunogen.
Degré de pureté :Min. 95%RGS20 antibody
RGS20 antibody was raised using the N terminal of RGS20 corresponding to a region with amino acids KHFSRPSIWTQFLPLFRAQRYNTDIHQITENEGDLRAVPDIKSFPPAQLP
ZHX2 antibody
The ZHX2 antibody is a powerful tool used in the field of Life Sciences. It specifically targets and binds to collagen, a protein found abundantly in the body. This antibody has shown antinociceptive properties, meaning it can help alleviate pain sensations. Additionally, it has been observed to be effective in inhibiting the activation of certain phosphorylation sites, which play a crucial role in cellular signaling pathways.
Degré de pureté :Min. 95%Factor VIIIc antibody
Factor VIIIc antibody was raised in mouse using human factor VIII antigen as the immunogen.
FADD antibody
The FADD antibody is a monoclonal antibody that targets α-syn, a protein associated with neurodegenerative diseases such as Parkinson's disease. It has been shown to neutralize the harmful effects of α-syn and reduce its accumulation in the brain. This antibody also inhibits endothelial growth factor and promotes the growth of mesenchymal stem cells, which are involved in tissue repair and regeneration. Additionally, the FADD antibody has been used to measure microvessel density in blood plasma samples using particle chemiluminescence emission. It is a valuable tool for researchers in the field of life sciences studying neurodegenerative diseases and angiogenesis.
Goat anti Mouse IgM (Fab'2)
Goat anti-mouse IgM (Fab'2) was raised in goat using murine IgM mu heavy chain as the immunogen.
Degré de pureté :Min. 95%NSE antibody
The NSE antibody is a powerful tool in the field of Life Sciences. It is a growth factor that neutralizes cytotoxic effects and chemokines in various biological processes. This antibody specifically targets TGF-beta, a protein known for its role in cell growth and differentiation. The NSE antibody can be used in research and diagnostic applications to detect and measure the levels of TGF-beta in samples. Additionally, it has been used as a therapeutic agent, particularly in the treatment of collagen-related diseases and as an inhibitor of anti-ACTH antibodies. Its versatility makes it an essential component for scientists studying various cellular processes and diseases, including Mycoplasma genitalium infections. Trust the NSE antibody to provide accurate and reliable results for your research needs.
CD122 antibody (FITC)
CD122 antibody (FITC) was raised in rat using rat myeloma YB2/0 transfected with truncated murine IL-2RB cDNA as the immunogen.
Degré de pureté :Min. 95%Masse moléculaire :0 g/molThrombospondin antibody
Thrombospondin antibody is a powerful tool used in Life Sciences research to study various biological processes. It specifically targets and detects the presence of thrombospondin, a protein involved in cell growth, angiogenesis, and wound healing. This antibody can be used in various applications such as immunohistochemistry, Western blotting, and enzyme-linked immunosorbent assay (ELISA). By binding to thrombospondin, this antibody allows researchers to investigate its role in different cellular pathways and understand its interactions with other molecules like epidermal growth factor (EGF), alpha-fetoprotein, serotonin, and c-myc. With its high specificity and sensitivity, the thrombospondin antibody provides valuable insights into the molecular mechanisms underlying these processes.
ENO1 antibody
The ENO1 antibody is a specific monoclonal antibody that targets the c-myc protein kinase. It has been shown to inhibit the growth factor signaling pathway and reduce microvessel density in monolayer cultures of MCF-7 cells. This antibody can be used for various applications, including immunohistochemistry, immunofluorescence, and Western blotting. It is highly sensitive and specific, making it an ideal tool for studying the expression and localization of ENO1 in different cell types. Additionally, this antibody has been used to detect autoantibodies against ENO1 in certain diseases, making it a valuable tool for diagnostic purposes. The ENO1 antibody is supplied as a polyclonal antibody and can be used with saponin or TGF-beta for enhanced staining results.
ATG16L1 antibody
ATG16L1 antibody was raised using a synthetic peptide corresponding to a region with amino acids RRQARLQKELAEAAKEPLPVEQDDDIEVIVDETSDHTEETSPVRAISRAA
HRas antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is known to effectively treat tuberculosis infections and contains active compounds that exhibit bactericidal activity. Through its mechanism of action, this drug inhibits bacterial growth by binding to DNA-dependent RNA polymerase, preventing transcription and replication. Its efficacy has been demonstrated through patch-clamp technique studies on human erythrocytes.
TSH beta antibody F(ab)'2 Fragment
TSH beta antibody was raised against Human TSH (intact).
Degré de pureté :Min. 95%DIDO1 antibody
DIDO1 antibody was raised in rabbit using the C terminal of DIDO1 as the immunogen
Degré de pureté :Min. 95%Mouse anti Rat IgG2a (HRP)
IgG2a antibody was raised in Mouse using Rat IgG2a as the immunogen.Degré de pureté :Min. 95%LIF antibody
The LIF antibody is a polyclonal antibody used in the field of Life Sciences. It specifically targets and inhibits the activity of leukemia inhibitory factor (LIF), which is an important growth factor involved in various cellular processes. This antibody can be used to study the role of LIF in different biological systems, including liver microsomes and hybridoma cells. By blocking the action of LIF, this antibody can potentially have cytotoxic effects on specific cell types, such as cholinergic and catecholaminergic neurons. Additionally, it may be useful for investigating the effects of LIF inhibitors on dopamine signaling pathways. With its high specificity and potency, the LIF antibody is a valuable tool for researchers studying the function and regulation of LIF in various physiological and pathological conditions.
PAK1 antibody
The PAK1 antibody is a cytotoxic agent that targets the PAK1 isoenzyme. It belongs to the group of Polyclonal Antibodies, which are widely used in Life Sciences research. This antibody specifically binds to PAK1 and inhibits its activity, making it an essential tool for studying the role of PAK1 in various cellular processes. The PAK1 antibody can be used in experiments involving collagen, epidermal growth factor, hepatocyte growth factor, and other related molecules. It is available as a monoclonal antibody, ensuring high specificity and reproducibility in experiments. Additionally, this antibody has been shown to be activated in the presence of certain autoantibodies and levothyroxine, making it a versatile tool for multiple applications.
Degré de pureté :Min. 95%HBsAg Mouse Monoclonal Antibody
Please enquire for more information about HBsAg Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page
Degré de pureté :Min. 95%Dengue Virus Type 1 Envelope Antigen, Recombinant
Please enquire for more information about Dengue Virus Type 1 Envelope Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page
Degré de pureté :Min. 95%Denosumab
CAS :Monoclonal antibody against RANKL; anti-resorptive agent for osteoperosis treatment
Degré de pureté :(Sec-Hplc) Min. 95 Area-%Couleur et forme :Clear LiquidCA 125 antibody (biotin)
CA 125 antibody (biotin) was raised in mouse using affinity pure human CA 125 antigen as the immunogen.
