Anticorps primaires

CSF2RA antibody was raised in Rabbit using Human CSF2RA as the immunogen

MAP2K2 antibody was raised using the N terminal of MAP2K2 corresponding to a region with amino acids LARRKPVLPALTINPTIAEGPSPTSEGASEANLVDLQKKLEELELDEQQK

The STAT2 antibody is a highly specialized antibody that plays a crucial role in the interferon signaling pathway. It specifically targets and binds to STAT2, a protein involved in regulating gene expression in response to interferon signals. By binding to STAT2, this antibody effectively inhibits its activity, preventing the downstream effects of interferon signaling.

The Fenitrothion antibody is a monoclonal antibody used in Life Sciences research. It specifically targets and binds to fenitrothion, a commonly used organophosphate insecticide. This antibody can be utilized for various applications, including immunoassays, Western blotting, and immunohistochemistry.

Rabbit anti-human patelet-activating factor acetylhydrolase(Lp-PLA2)  polyclonal Antibody

Mouse monoclonal PCK 26 antibody

ATP6V1G2 antibody was raised in rabbit using the middle region of ATP6V1G2 as the immunogen

The Parathyroid Hormone antibody is a powerful tool in the field of Life Sciences. This monoclonal antibody specifically targets and binds to Parathyroid Hormone, allowing for precise detection and analysis. It has been extensively used in research studies to investigate the role of Parathyroid Hormone in various biological processes.

Goat anti-rabbit IgG (FITC) was raised in goat using rabbit IgG F(c) whole molecule as the immunogen.

Mouse monoclonal ELK3 antibody

The SCF antibody is a polyclonal antibody that has the ability to neutralize the activity of stem cell factor (SCF). Stem cell factor is an important growth factor involved in various cellular processes, including cell proliferation, differentiation, and survival. The SCF antibody can specifically bind to SCF and inhibit its function, preventing it from interacting with its receptor and initiating downstream signaling pathways.

IL3 antibody was raised in rabbit using highly pure recombinant murine IL-3 as the immunogen.

Goat anti-syrian hamster IgG (H + L) (biotin) was raised in goat using hamster IgG (H & L) as the immunogen.

Rabbit polyclonal CEB alpha antibody (Ser21)

Mouse monoclonal CBWD1 antibody

AGT antibody was raised using a synthetic peptide corresponding to a region with amino acids IHPFHLVIHNESTCEQLAKANAGKPKDPTFIPAPIQAKTSPVDEKALQDQ

CD105 antibody was raised in rabbit using recombinant human soluble CD105/Endoglin as the immunogen.

Rabbit anti-sheep IgG (Rhodamine) was raised in rabbit using sheep IgG F(c) fragment as the immunogen.

The EGFR antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It is designed to specifically target and neutralize the epidermal growth factor receptor (EGFR), a protein that plays a crucial role in cell growth and division. This antibody can be used in various applications, such as chemiluminescent immunoassays, where it enables the detection and quantification of EGFR levels in samples.

The FZD6 antibody is a highly specialized monoclonal antibody that targets the insulin-like growth factor receptor (IGF-1R). It is designed to specifically bind to the IGF-1R and inhibit its activity. This antibody has shown promising results in preclinical studies, demonstrating its potential as a therapeutic agent for various diseases, including cancer.

XYLT2 antibody was raised using the C terminal of XYLT2 corresponding to a region with amino acids LRPGPWTVRLLQFWEPLGETRFLVLPLTFNRKLPLRKDDASWLHAGPPHN

Goat anti-human IgG (Alk Phos) was raised in goat using human IgG F(c) fragment as the immunogen.

TSH beta antibody was raised against Human TSH (intact).

POLK antibody was raised using a synthetic peptide corresponding to a region with amino acids ATECTLEKTDKDKFVKPLEMSHKKSFFDKKRSERKWSHQDTFKCEAVNKQ

Rabbit polyclonal NFkB p100 antibody (Ser872)

EMID1 antibody was raised using the C terminal of EMID1 corresponding to a region with amino acids TMIGLYEPELGSGAGPAGTGTPSLLRGKRGGHATNYRIVAPRSRDERG

Streptococcus group A antibody was raised in rabbit using group A Streptococci as the immunogen.

Goat anti-rat IgM (Alk Phos) was raised in goat using rat IgM mu chain as the immunogen.

Please enquire for more information about HBsAg Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page

Please enquire for more information about Dengue Virus Type 1 Envelope Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page

Monoclonal antibody against RANKL; anti-resorptive agent for osteoperosis treatment

CA 125 antibody (biotin) was raised in mouse using affinity pure human CA 125 antigen as the immunogen.

Cortisol antibody was raised in mouse using cortisol-3 BSA as the immunogen.