Anticorps primaires
Sous-catégories appartenant à la catégorie "Anticorps primaires"
- Anticorps pour la recherche sur le cancer(3.721 produits)
- Anticorps cardio-vasculaires(2 produits)
- Biologie du développement(764 produits)
- Anticorps relatifs à l’épigénétique(162 produits)
- Anticorps d'immunologie(2.585 produits)
- Anticorps du métabolisme(286 produits)
- Anticorps de microbiologie(741 produits)
- Transduction du signal(2.765 produits)
- Tags & Marqueurs cellulaires(34 produits)
75562 produits trouvés pour "Anticorps primaires"
DKK3 antibody
The DKK3 antibody is a polyclonal antibody that specifically targets the glycoprotein DKK3. It is commonly used in life sciences research to study the role of DKK3 in various biological processes. This antibody has been shown to have neuroprotective properties and can inhibit cytotoxic effects induced by insulin. Additionally, it has been found to possess anticoagulant activity and can bind to phospholipids, making it useful for studying antiphospholipid antibodies. The DKK3 antibody is a valuable tool for researchers investigating the function and therapeutic potential of DKK3 in different contexts.
CSE1L antibody
The CSE1L antibody is a cytotoxic monoclonal antibody that targets the epidermal growth factor (EGF) receptor. It is widely used in life sciences research to study the role of EGF and its signaling pathways. This antibody specifically binds to the activated form of the EGF receptor, inhibiting its function and preventing downstream signaling events. The CSE1L antibody has been shown to be effective in blocking the growth and proliferation of cancer cells that overexpress the EGF receptor, making it a promising therapeutic candidate for cancer treatment. Additionally, this antibody can be used as a tool in various experimental techniques, such as immunohistochemistry and Western blotting, to detect and quantify EGF receptor expression levels in different cell types and tissues. With its high specificity and sensitivity, the CSE1L antibody is an invaluable resource for researchers studying EGF-related signaling pathways and their implications in various biological processes.
Tetraspanin 32 antibody
Tetraspanin 32 antibody was raised using the middle region of TSPAN32 corresponding to a region with amino acids EDCLQGIRSFLRTHQQVASSLTSIGLALTVSALLFSSFLWFAIRCGCSLD
CSB antibody
CSB antibody is a high-quality polyclonal antibody that targets specific proteins and antigens in various life science applications. This antibody is widely used in research and diagnostics due to its exceptional sensitivity and specificity. It has been extensively validated for its ability to detect and neutralize a wide range of target proteins, including neurotrophic factors, glucagon, endothelial growth factors, and more. The CSB antibody utilizes advanced phosphatase technology and colloidal electrodes to ensure accurate and reliable results. Whether you are studying protein expression, conducting immunoassays, or investigating cellular pathways, the CSB antibody is an indispensable tool for your research needs. Trust in its superior performance to accelerate your scientific discoveries.
MELK antibody
The MELK antibody is a highly specialized product in the field of Life Sciences. It is designed to target and neutralize the activity of Maternal Embryonic Leucine Zipper Kinase (MELK), a nuclear protein that plays a crucial role in various cellular processes. This antibody has been extensively studied and proven to be effective in inhibiting the growth and proliferation of cancer cells.
CEA antibody
The CEA antibody is a monoclonal antibody used in Life Sciences. It has pro-angiogenic activity, meaning it promotes the growth of new blood vessels. This antibody can be used in various research applications, such as immunoassays and immunohistochemistry, to detect and quantify CEA (carcinoembryonic antigen) levels. CEA is a protein that is often elevated in certain types of cancer, particularly colorectal cancer. By targeting CEA, this antibody can help researchers better understand the role of CEA in cancer development and progression. Additionally, the CEA antibody has been shown to interact with other proteins, such as annexin A2 and epidermal growth factor, suggesting potential involvement in signaling pathways related to cell growth and proliferation. With its high specificity and sensitivity, the CEA antibody is a valuable tool for studying CEA-related processes and developing diagnostic tests for cancer detection.Eotaxin 3 antibody (biotin)
Eotaxin 3 antibody (biotin) was raised in goat using highly pure recombinant human eotaxin-3 as the immunogen.
CIAPIN1 antibody
The CIAPIN1 antibody is a highly specialized product in the field of Life Sciences. It is an antibody that specifically targets and binds to the CIAPIN1 protein. This protein has been shown to play a crucial role in various cellular processes, including cell growth, apoptosis, and immune response.
Goat anti-Human IgG antibody
The Goat anti-Human IgG antibody is a powerful tool used in Life Sciences research. This monoclonal antibody specifically targets and neutralizes human IgG, making it an essential component for various applications.
SLC12A2 antibody
SLC12A2 antibody was raised using a synthetic peptide corresponding to a region with amino acids IIAFEEIIEPYRLHEDDKEQDIADKMKEDEPWRITDNELELYKTKTYRQI
STK11 antibody
STK11 antibody was raised using the N terminal of STK11 corresponding to a region with amino acids TLCRRAVKILKKKKLRRIPNGEANVKKEIQLLRRLRHKNVIQLVDVLYNE
Complement factor H antibody
The Complement factor H antibody is a highly specialized antibody that plays a crucial role in the regulation of the immune system. It binds to glutamate and other molecules to prevent excessive activation of the complement system, which can lead to inflammation and tissue damage. This antibody is widely used in life sciences research, particularly in studies related to insulin, lipoprotein lipase, and heparin-induced thrombocytopenia. It is also used as a diagnostic tool for detecting insulin antibodies and as a therapeutic agent for targeting growth factors such as trastuzumab and epidermal growth factor. With its high specificity and affinity for its target molecules, this monoclonal antibody is an essential component in many medicaments and has proven to be invaluable in various research applications.
AURKA antibody
The AURKA antibody is a monoclonal antibody that targets glial fibrillary acidic protein (GFAP). It is commonly used in research and diagnostics to detect the presence of GFAP, which is an important marker for astrocytes. This antibody can be used in various applications, including immunohistochemistry, western blotting, and flow cytometry. Additionally, it has been shown to be effective in detecting amyloid plaques in Alzheimer's disease brain tissue. The AURKA antibody is also useful for studying the role of protein kinases in cellular processes, as it specifically targets Aurora kinase A (AURKA). It can be used as a tool to inhibit the activity of AURKA and study its downstream effects on cell division and proliferation. In summary, the AURKA antibody is a valuable tool for researchers in the life sciences field who are studying various aspects of cellular biology and disease mechanisms.
GCNT3 antibody
GCNT3 antibody was raised using a synthetic peptide corresponding to a region with amino acids AICVYGAGDLNWMLQNHHLLANKFDPKVDDNALQCLEEYLRYKAIYGTEL
TRIM32 antibody
The TRIM32 antibody is a powerful tool used in the field of Life Sciences. It is an antibody that specifically targets and binds to TRIM32, a protein involved in various cellular processes. This antibody has been extensively studied and proven to be effective in various applications.
FZD9 antibody
FZD9 antibody was raised using a synthetic peptide corresponding to a region with amino acids RPPGDLGPGAGGSGTCENPEKFQYVEKSRSCAPRCGPGVEVFWSRRDKDF
Desmin antibody
The Desmin antibody is an important tool in the field of Life Sciences. It is a monoclonal antibody that specifically targets Desmin, a protein involved in muscle cell structure and function. This antibody has been widely used in research to study the role of Desmin in various biological processes.
Pleiotrophin antibody
The Pleiotrophin antibody is a highly versatile and reactive chemokine that plays a crucial role in various biological processes. This antibody is available as both polyclonal and monoclonal forms, offering researchers flexibility in their experimental designs. It has been extensively studied in the field of Life Sciences due to its ability to neutralize the effects of Pleiotrophin, thereby modulating cellular functions.
HBsAg Mouse Monoclonal Antibody
Please enquire for more information about HBsAg Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page
Degré de pureté :Min. 95%Dengue Virus Type 1 Envelope Antigen, Recombinant
Please enquire for more information about Dengue Virus Type 1 Envelope Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page
Degré de pureté :Min. 95%Denosumab
CAS :Monoclonal antibody against RANKL; anti-resorptive agent for osteoperosis treatment
Degré de pureté :(Sec-Hplc) Min. 95 Area-%Couleur et forme :Clear LiquidCA 125 antibody (biotin)
CA 125 antibody (biotin) was raised in mouse using affinity pure human CA 125 antigen as the immunogen.
