Anticorps primaires

Rabbit polyclonal USP12 antibody

DDT antibody is an activated phosphatase that belongs to the class of monoclonal antibodies. It is used in life sciences research for various applications, including immunohistochemistry, Western blotting, and ELISA. DDT antibody specifically binds to DDT (dichlorodiphenyltrichloroethane), a synthetic insecticide that was widely used in the past but has since been banned due to its harmful effects on the environment and human health. This antibody can be used to detect and neutralize DDT in samples such as human serum or environmental samples. It has high affinity and specificity for DDT and does not cross-react with other compounds. The DDT antibody is conjugated with a fluorescent or enzymatic tag, allowing for easy detection and quantification of DDT in various assays.

Collagen type IV antibody (biotin) was raised in rabbit using collagen type IV from human and bovine placenta as the immunogen.

Affinity purified Rabbit polyclonal CD172 gamma antibody

Desmoglein 2 antibody is a highly specific monoclonal antibody that is used in various research and diagnostic applications. It is designed to bind to desmoglein 2, a protein that plays a critical role in cell-cell adhesion in epithelial tissues. This antibody can be immobilized on an electrode surface for use in biosensor applications or used in immunohistochemistry and Western blotting techniques.

Mouse monoclonal Dengue NS1 antibody (Subtype 4). Supplied in PBS buffer with sodium azide

Rabbit polyclonal PEX1 antibody

Mouse monoclonal CD38 antibody (FITC)

CHMP1B antibody was raised in Rabbit using Human CHMP1B as the immunogen

Rabbit polyclonal SFRS7 antibody

The LHR antibody is a polyclonal antibody used in life sciences research. It specifically targets the luteinizing hormone receptor (LHR), which plays a crucial role in reproductive processes. This antibody is commonly used to study the interaction between LHR and various ligands, such as chemokines, on the microvascular endothelium. It can also be used in antigen-antibody reactions to detect the presence of LHR in different tissues or cell types. The LHR antibody is available as both polyclonal and monoclonal antibodies, providing researchers with options for their specific experimental needs. With its high specificity and sensitivity, this antibody is an invaluable tool for investigating the function and regulation of LHR in various biological contexts.

Rabbit polyclonal Tau antibody (Ser422)

Affinity purified Rabbit polyclonal TFIID antibody

PAIP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids EPTFYTSDGVPFTAADPDYQEKYQELLEREDFFPDYEENGTDLSGAGDPY

The PNMT antibody is a highly specialized product in the field of Life Sciences. It is a monoclonal antibody that specifically targets and binds to the enzyme phenylethanolamine N-methyltransferase (PNMT). This enzyme plays a crucial role in the synthesis of norepinephrine, a neurotransmitter involved in various physiological processes.

METTL5 antibody was raised in Rabbit using Human METTL5 as the immunogen

CD45.2 antibody was raised in mouse using CD45.2 as the immunogen.

Mouse monoclonal MRPS2 antibody

Rabbit polyclonal SEC22B antibody

Rabbit polyclonal SDF2L1 antibody

UTS2D antibody was raised in rabbit using the C terminal of UTS2D as the immunogen

The GPR171 antibody is a highly specialized monoclonal antibody that targets the GPR171 receptor. This receptor plays a crucial role in various biological processes, including erythropoietin signaling, TNF-α production, chemokine regulation, and microvessel density. The GPR171 antibody has been extensively studied and proven to be highly effective in neutralizing the activity of GPR171.

The Interferon alpha Receptor 1 antibody is a highly specialized polyclonal antibody that is used in immunoassays. This antibody specifically targets the Interferon alpha Receptor 1 protein, which plays a crucial role in the immune response. It can be used for various applications, including Western blotting, immunoprecipitation, and immunohistochemistry.

Factor IX antibody (biotin) was raised in goat using human Factor IX purified from plasma as the immunogen.

YIPF4 antibody was raised in rabbit using the N terminal of YIPF4 as the immunogen

CARM1 antibody was raised in Rabbit using Human CARM1 as the immunogen

SSBP3 antibody was raised using the middle region of SSBP3 corresponding to a region with amino acids SNFPMGPGSDGPMGGMGGMEPHHMNGSLGSGDIDGLPKNSPNNISGISNP

PTHLH antibody was raised using the middle region of PTHLH corresponding to a region with amino acids YKEQPLKTPGKKKKGKPGKRKEQEKKKRRTRSAWLDSGVTGSGLEGDHLS

The GALNT7 antibody is a highly specific polyclonal antibody that targets GALNT7, an enzyme responsible for adding sugar molecules to proteins. This antibody recognizes specific acid residues in GALNT7 and can be used for various applications in life sciences research. It has been extensively validated and shown to have high affinity and specificity for GALNT7.

RPL7 antibody was raised in rabbit using the C terminal of RPL7 as the immunogen

The Fibronectin antibody is an antigen binding molecule that specifically targets fibronectin, a protein involved in cell adhesion and migration. It has been shown to inhibit the activation of tyrosine kinase receptors and block the binding of fibronectin to its receptors on cells. This antibody can be used in various applications such as immunohistochemistry, western blotting, and flow cytometry to study the biological effects of fibronectin in different tissues and cell types.

Mouse monoclonal POLR2J2 antibody

HIV1 p17 antibody was raised in mouse using HIV1 p17 as the immunogen.

GSTM4 antibody was raised in Rabbit using Human GSTM4 as the immunogen

LIPT1 antibody was raised using the N terminal of LIPT1 corresponding to a region with amino acids NCFQLLCNCQVPAAGFKKTVKNGLILQSISNDVYQNLAVEDWIHDHMNLE

The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections, thanks to its bactericidal activity. This active compound works by binding to DNA-dependent RNA polymerase, which prevents transcription and replication, inhibiting bacterial growth. The efficacy of this drug has been demonstrated through the use of a patch-clamp technique on human erythrocytes.

The Prolactin Receptor antibody is a growth factor that belongs to the class of monoclonal antibodies. It has neutralizing properties and can effectively inhibit the activity of prolactin, a hormone involved in lactation and reproductive functions. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in various research applications.

The Ki67 antibody is a highly specialized product used in Life Sciences research. It is a monoclonal antibody produced by a hybridoma cell line, specifically designed for the immunohistochemical detection of activated cells. The Ki67 antibody targets the Ki67 protein, which is a marker of cellular proliferation and is commonly used as a growth factor indicator.

The ZO1 antibody is a highly effective monoclonal antibody that specifically targets CD33, a cell surface protein. This antibody is widely used in the field of life sciences for various applications. It has been shown to inhibit the growth of cancer cells, such as MCF-7 breast cancer cells, by blocking the action of growth factors and interfering with cell signaling pathways. Additionally, the ZO1 antibody has been used in research involving mesenchymal stem cells to study their differentiation potential and therapeutic applications. Furthermore, this antibody can be utilized in immunohistochemistry and western blotting assays to detect and quantify specific proteins of interest. With its exceptional specificity and sensitivity, the ZO1 antibody is an invaluable tool for scientists and researchers in their quest for new discoveries in the field of molecular biology.

Please enquire for more information about Dengue Virus Type 1 Envelope Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page

Please enquire for more information about HBsAg Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page

Monoclonal antibody against RANKL; anti-resorptive agent for osteoperosis treatment

CA 125 antibody (biotin) was raised in mouse using affinity pure human CA 125 antigen as the immunogen.

Cortisol antibody was raised in mouse using cortisol-3 BSA as the immunogen.