Anticorps primaires

The CD44 antibody is a monoclonal antibody used in the field of Life Sciences. It is specifically designed to target and bind to CD44, a cell surface glycoprotein that plays a crucial role in cell adhesion and migration. This antibody has been extensively studied for its ability to inhibit the growth and metastasis of various types of cancer cells.

Affinity purified Rabbit polyclonal CDC26 antibody

Affinity purified Rabbit polyclonal PPP3CB antibody

The RXRB antibody is a monoclonal antibody that targets the retinoid X receptor beta (RXRB). This receptor is involved in various cellular processes, including growth and development. The RXRB antibody has been shown to have cytotoxic effects on cancer cells, particularly in HL-60 cells. It binds to specific binding proteins and inhibits the activity of tumor necrosis factor-alpha (TNF-α) and vascular endothelial growth factor (VEGF), which are important factors in cancer progression. Additionally, the RXRB antibody has been found to have anti-glycation properties and may play a role in regulating hormone peptides. In the field of Life Sciences, this antibody is widely used for research purposes, including studying signal transduction pathways and developing targeted therapies. It is also being investigated as a potential family kinase inhibitor and an anti-CD33 antibody for the treatment of certain types of leukemia.

RNF19A antibody was raised using the N terminal of RNF19A corresponding to a region with amino acids IFSTNTSSDNGLTSISKQIGDFIECPLCLLRHSKDRFPDIMTCHHRSCVD

BCL2A1 antibody was raised in rabbit using the C terminal of BCL2A1 as the immunogen

Affinity purified Rabbit polyclonal Galanin Receptor 2 antibody

NDUFS5 antibody was raised in Rabbit using Human NDUFS5 as the immunogen

RRM1 antibody was raised using the C terminal of RRM1 corresponding to a region with amino acids MHFYGWKQGLKTGMYYLRTRPAANPIQFTLNKEKLKDKEKVSKEEEEKER

LNX1 antibody was raised using the C terminal of LNX1 corresponding to a region with amino acids SHREWDLPIYVISVEPGGVISRDGRIKTGDILLNVDGVELTEVSRSEAVA

Human IgG Fc antibody was raised in goat using human IgG, Fc fragment as the immunogen.

IDH2 antibody was raised in Rabbit using Human IDH2 as the immunogen

HBXIP antibody was raised using the N terminal of HBXIP corresponding to a region with amino acids EPGAGHLDGHRAGSPSLRQALCDGSAVMFSSKERGRCTVINFVPLEAPLR

Rabbit polyclonal GSK3 beta antibody (Ser9)

OR13C9 antibody was raised in rabbit using the middle region of OR13C9 as the immunogen

CAPN11 antibody was raised in Rabbit using Human CAPN11 as the immunogen

Rabbit anti-Human PIEZO1 Polyclonal antibody

Affinity purified Rabbit polyclonal Myotubularin related protein 4 antibody

MRPS2 antibody was raised using the N terminal of MRPS2 corresponding to a region with amino acids MATSSAALPRILGAGARAPSRWLGFLGKATPRPARPSRRTLGSATALMIR

FSH antibody was raised in mouse using high purity intact FSH from human pituitary gland as the immunogen.

Toxoplasma gondii antibody was raised in mouse using 30 kDa membrane protein of purified Toxoplasma gondii as the immunogen.

GSG1 antibody was raised using the C terminal of GSG1 corresponding to a region with amino acids VGPLTSYHQYHNQPIHSVSEGVDFYSELRNKGFQRGASQELKEAVRSSVE

TRNT1 antibody was raised using the N terminal of TRNT1 corresponding to a region with amino acids PQDIDFATTATPTQMKEMFQSAGIRMINNRGEKHGTITARLHEENFEITT

PPP1R12A antibody was raised in rabbit using the C terminal of PPP1R12A as the immunogen

Rabbit polyclonal UCKL1 antibody

Rabbit polyclonal GPR92 antibody

CDCA8 antibody was raised in Rabbit using Human CDCA8 as the immunogen

Rabbit polyclonal T3JAM antibody

MIP4 antibody was raised in rabbit using highly pure recombinant hMIP-4 as the immunogen.

TBC1D16 antibody was raised using the middle region of TBC1D16 corresponding to a region with amino acids RGEVWPFLLRYYSHESTSEEREALRLQKRKEYSEIQQKRLSMTPEEHRAF

DDX49 antibody was raised using a synthetic peptide corresponding to a region with amino acids ELAYQIAEQFRVLGKPLGLKDCIIVGGMDMVAQALELSRKPHVVIATPGR

The GSTO1 antibody is a highly specialized antibody that targets specific proteins and molecules in the body. It has been extensively studied for its ability to interact with various substances, including anti-ACTH antibodies, adiponectin, annexin, and adiponectin receptor. The GSTO1 antibody has also been found to inhibit the activity of family kinase inhibitors and fibrinogen.

Affinity purified Rabbit polyclonal GPRC6A antibody

PYGO1 antibody was raised in rabbit using the middle region of PYGO1 as the immunogen

Affinity purified Rabbit polyclonal VPS11 antibody

FITC antibody (biotin) was raised in goat using fluorescein conjugated to goat IgG as the immunogen.

Affinity purified Rabbit polyclonal GADD45 gamma antibody

Endoglin antibody was raised using a synthetic peptide corresponding to a region with amino acids ILEVHVLFLEFPTGPSQLELTLQASKQNGTWPREVLLVLSVNSSVFLHLQ

Rabbit polyclonal Coflin 1 and Cofilin 2 antibody

Affinity purified Rabbit polyclonal LRP130 antibody

Cytokeratin 10 antibody is a monoclonal antibody that specifically targets and binds to cytokeratin 10, a protein found in epithelial cells. This antibody is commonly used in life sciences research to study the expression and localization of cytokeratin 10 in various tissues and cell types. Cytokeratin 10 plays a crucial role in maintaining the structural integrity of epithelial cells and is involved in cell adhesion, migration, and differentiation processes. By targeting cytokeratin 10, this antibody enables researchers to gain valuable insights into the cellular mechanisms underlying tissue development, wound healing, and diseases such as cancer. With its high specificity and sensitivity, the cytokeratin 10 antibody is an essential tool for scientists investigating the complex functions of epithelial cells in both normal and pathological conditions.

The VEGFD antibody is a powerful tool in the field of Life Sciences. It acts as an inhibitor against TGF-β1 and chemokine, making it an essential component in various research studies. This monoclonal antibody has shown inhibitory properties against protein kinase, insulin, and natriuretic factors. Its unique design allows for precise targeting and binding to specific molecules, ensuring accurate results in immunoassays. With its ability to neutralize interferon activity, the VEGFD antibody opens up new possibilities for studying neurotrophic factors and their role in different biological processes. Researchers can rely on this high-quality antibody to enhance their experiments and gain valuable insights into cellular mechanisms.

Monoclonal antibody against RANKL; anti-resorptive agent for osteoperosis treatment

Please enquire for more information about HBsAg Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page

Please enquire for more information about Dengue Virus Type 1 Envelope Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page

CA 125 antibody (biotin) was raised in mouse using affinity pure human CA 125 antigen as the immunogen.

Cortisol antibody was raised in mouse using cortisol-3 BSA as the immunogen.