Anticorps primaires

The C1R antibody is a highly specialized protein that plays a crucial role in various life sciences applications. This antibody is specifically designed to target and neutralize the activity of certain proteins, such as growth factors and autoantibodies, which are involved in various biological processes.

Rabbit polyclonal SPANXC antibody

HHIPL1 antibody was raised in rabbit using the C terminal of HHIPL1 as the immunogen

The NKG2D antibody is a highly specialized antibody that targets the vasoactive intestinal peptide. It belongs to the class of polyclonal antibodies and exhibits cytotoxic effects. This monoclonal antibody is designed to specifically bind to autoantibodies, preventing their harmful effects on the body. With its unique structure and composition of lysine and acid residues, this antibody has the ability to induce lysis of targeted cells. Its multidrug properties make it highly effective in combating various diseases and conditions. The NKG2D antibody is activated upon binding to necrosis factor-related apoptosis-inducing markers, leading to targeted cell death. Its nuclear-specific targeting makes it a valuable tool in research and diagnostics. With its multispecific nature, this monoclonal antibody offers a versatile solution for a wide range of applications.

Rabbit polyclonal UQCRQ antibody

Rabbit polyclonal BDNF antibody (HRP)

UBE2L3 antibody was raised using the C terminal of UBE2L3 corresponding to a region with amino acids  TDQVIQSLIALVNDPQPEHPLRADLAEEYSKDRKKFCKNAEEFTKKYGEK

The AKR1B10 antibody is a highly specialized product used in the field of Life Sciences. It is a polyclonal antibody that specifically targets AKR1B10, an enzyme involved in various cellular processes. This antibody offers high photostability and has been extensively tested for its specificity and sensitivity.

Purified Polyclonal PAX9 antibody

Purified Polyclonal NAA15 antibody

CD19 antibody (Spectral Red) was raised in mouse using CD19+ murine pre-B cell line as the immunogen.

Rabbit Polyclonal SIX5 antibody

Purified Polyclonal PPP4R1L antibody

PTCH1 antibody was raised in rabbit using residues 269-279 [KKINYQVDSWE] of the murine PTCH protein as the immunogen.

The CSE1L antibody is a cytotoxic monoclonal antibody that targets the epidermal growth factor (EGF) receptor. It is widely used in life sciences research to study the role of EGF and its signaling pathways. This antibody specifically binds to the activated form of the EGF receptor, inhibiting its function and preventing downstream signaling events. The CSE1L antibody has been shown to be effective in blocking the growth and proliferation of cancer cells that overexpress the EGF receptor, making it a promising therapeutic candidate for cancer treatment. Additionally, this antibody can be used as a tool in various experimental techniques, such as immunohistochemistry and Western blotting, to detect and quantify EGF receptor expression levels in different cell types and tissues. With its high specificity and sensitivity, the CSE1L antibody is an invaluable resource for researchers studying EGF-related signaling pathways and their implications in various biological processes.

Rabbit polyclonal RUVBL2 antibody

This antibody reacts with heavy chains on human IgG (gamma chain) and light chains on all human immunoglobulins.

Affinity purified Rabbit polyclonal ALPL antibody

DONSON antibody was raised using the middle region of DONSON corresponding to a region with amino acids DLITALISPTTRGLREAMRNEGIEFSLPLIKESGHKKETASGTSLGYGEE

The Cul4B antibody is a highly specialized and versatile tool used in Life Sciences research. It is a polyclonal antibody that specifically targets the Cul4B protein, which plays a crucial role in various cellular processes. The Cul4B protein is involved in the regulation of epidermal growth factor signaling, parathyroid hormone-related protein expression, and chemokine-like activity.

Mouse monoclonal DO11.10 TCR antibody (PE)

HNRPDL antibody was raised in Rabbit using Human HNRPDL as the immunogen

The CBS antibody is a highly specialized product in the field of Life Sciences. It falls under the category of antibodies and is specifically designed for human serum. This antibody exhibits cytotoxic properties, making it an effective tool for various applications such as immunohistochemistry, flow cytometry, and Western blotting.

EXOSC5 antibody was raised in Rabbit using Human EXOSC5 as the immunogen

Rabbit polyclonal ZNF592 antibody (FITC)

Peptide YY antibody is a calcitonin-like peptide that plays a role in regulating pancreatic insulin secretion. It is an activated and stable analogue of the peptide YY hormone. This antibody has been used in various studies in Life Sciences to investigate its effects on cholinergic and thyrotropin-releasing hormone-induced insulin secretion. Peptide YY antibody has also been utilized in research involving microinjection and subthreshold dose experiments, as well as the use of antisense oligodeoxynucleotides. This polyclonal antibody binds specifically to peptide YY, allowing for the detection and analysis of this hormone in different experimental settings.

WNT10B antibody was raised in Mouse using a purified recombinant fragment of human WNT10B expressed in E. coli as the immunogen.

Rabbit polyclonal PIP5K3 antibody

Rabbit polyclonal GPR123 antibody

Rabbit polyclonal OR2AK2 antibody

Affinity purified Rabbit polyclonal Calpain 5 antibody

The DUSP22 antibody is a powerful tool used in the field of Life Sciences. It belongs to the class of interferon antibodies that specifically target and bind to DUSP22, a protein involved in various cellular processes. This antibody is designed to recognize specific polypeptide sequences found in DUSP22 and can be used for research purposes such as studying its expression levels or investigating its role in different biological pathways.

ARHGAP25 antibody was raised using the middle region of ARHGAP25 corresponding to a region with amino acids SPGEEASALSSQACDSKGDTLASPNSETGPGKKNSGEEEIDSLQRMVQEL

The DDX3Y antibody is a polyclonal antibody that has minimal toxicity and is widely used in the field of Life Sciences. It plays a crucial role in various biological processes, including colony-stimulating factor production, chemokine signaling, and immune response modulation. This antibody can be used for cytometry analysis to detect the presence of DDX3Y protein in cells or tissues.

ADRBK1 antibody was raised in Rabbit using Human ADRBK1 as the immunogen

Mouse monoclonal CXCR1 antibody

GNB3 antibody was raised in Rabbit using Human GNB3 as the immunogen

The AURKA antibody is a monoclonal antibody that targets glial fibrillary acidic protein (GFAP). It is commonly used in research and diagnostics to detect the presence of GFAP, which is an important marker for astrocytes. This antibody can be used in various applications, including immunohistochemistry, western blotting, and flow cytometry. Additionally, it has been shown to be effective in detecting amyloid plaques in Alzheimer's disease brain tissue. The AURKA antibody is also useful for studying the role of protein kinases in cellular processes, as it specifically targets Aurora kinase A (AURKA). It can be used as a tool to inhibit the activity of AURKA and study its downstream effects on cell division and proliferation. In summary, the AURKA antibody is a valuable tool for researchers in the life sciences field who are studying various aspects of cellular biology and disease mechanisms.

Rabbit anti-human IgG was raised in rabbit using human IgG F(c) fragment as the immunogen.

Monoclonal antibody against RANKL; anti-resorptive agent for osteoperosis treatment

Please enquire for more information about Dengue Virus Type 1 Envelope Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page

CA 125 antibody (biotin) was raised in mouse using affinity pure human CA 125 antigen as the immunogen.

Cortisol antibody was raised in mouse using cortisol-3 BSA as the immunogen.