Anticorps primaires

CD69 antibody (biotin) was raised in hamster using Y245 murine dendritic epidermal T cell line as the immunogen.

Rabbit polyclonal TBX2 antibody

The purified Cat IgG h+l can be utilized for ELISA, Western Blot and as a Blocking Agent. Please inquire for bulk pricing.

Myosin Ic antibody was raised using the N terminal of MYO1C corresponding to a region with amino acids NPVLEAFGNAKTLRNDNSSRFGKYMDVQFDFKGAPVGGHILSYLLEKSRV

The LIMK1 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It is designed to target and bind to the LIMK1 protein, which plays a crucial role in cellular processes such as cell migration and cytoskeletal organization. This antibody can be used in various applications, including immunohistochemistry, Western blotting, and flow cytometry.

Affinity purified Goat anti Human IgG antibody

The ZHX2 antibody is a powerful tool used in the field of Life Sciences. It specifically targets and binds to collagen, a protein found abundantly in the body. This antibody has shown antinociceptive properties, meaning it can help alleviate pain sensations. Additionally, it has been observed to be effective in inhibiting the activation of certain phosphorylation sites, which play a crucial role in cellular signaling pathways.

HHIPL1 antibody was raised in rabbit using the C terminal of HHIPL1 as the immunogen

The NSE antibody is a highly specialized monoclonal antibody that is used in various medical applications. It is commonly used in electrophoresis and high-dose chemotherapy procedures. This antibody specifically targets histone deacetylase inhibitors, which are involved in regulating gene expression and cell growth.

IMMP2L antibody was raised in Rabbit using Human IMMP2L as the immunogen

ZKSCAN1 antibody was raised in rabbit using the N terminal of ZKSCAN1 as the immunogen

Rabbit polyclonal PLD1 antibody (Ser561)

The PAK1 antibody is a cytotoxic agent that targets the PAK1 isoenzyme. It belongs to the group of Polyclonal Antibodies, which are widely used in Life Sciences research. This antibody specifically binds to PAK1 and inhibits its activity, making it an essential tool for studying the role of PAK1 in various cellular processes. The PAK1 antibody can be used in experiments involving collagen, epidermal growth factor, hepatocyte growth factor, and other related molecules. It is available as a monoclonal antibody, ensuring high specificity and reproducibility in experiments. Additionally, this antibody has been shown to be activated in the presence of certain autoantibodies and levothyroxine, making it a versatile tool for multiple applications.

Rabbit polyclonal PSMB1 antibody (HRP)

PTH antibody was raised in goat using human PTH as the immunogen.

HPV18 antibody was raised in mouse using papilloma virus type 18 as the immunogen.

Rabbit polyclonal SEMA4B antibody

TUSC4 antibody was raised in rabbit using the middle region of TUSC4 as the immunogen

CD2 antibody (PE) was raised in rat using CD2/LFA-2 as the immunogen.

Rabbit polyclonal TNFSF9 antibody (HRP)

CD8B antibody was raised using the N terminal of CD8B corresponding to a region with amino acids RIYWLRQRQAPSSDSHHEFLALWDSAKGTIHGEEVEQEKIAVFRDASRFI

The C-peptide antibody is a synthetic, recombinant protein that has been activated for use in various life sciences assays. This antibody is specifically designed to detect and bind to C-peptide, a protein fragment that is cleaved from proinsulin during insulin synthesis. The C-peptide antibody can be used in electrophoresis and other laboratory techniques to study the presence and function of C-peptide in human serum samples. This monoclonal antibody is highly specific and has been extensively characterized for its performance and reliability. It can be used as a valuable tool in research and diagnostic applications related to diabetes, insulin secretion, and related disorders. With its buffered formulation and high sensitivity, the C-peptide antibody ensures accurate and reproducible results in various experimental settings. Trust this antibody for your research needs in the field of endocrinology and beyond.

NIP7 antibody was raised in Rabbit using Human NIP7 as the immunogen

GPR161 antibody was raised in Rabbit using Human GPR161 as the immunogen

Rabbit polyclonal TERF2IP antibody

Fibronectin antibody was raised in rabbit using fibronectin purified from human plasma as the immunogen.

H2AFY2 antibody was raised using the middle region of H2AFY2 corresponding to a region with amino acids KKGGKKSKAAKPRTSKKSKPKDSDKEGTSNSTSEDGPGDGFTILSSKSLV

CD11c antibody (FITC) was raised in Mouse using human rheumatoid synovial fluid cells/monocytes as the immunogen.

The PYK2 antibody is a highly specific monoclonal antibody that targets PYK2, a tyrosine kinase protein involved in various cellular processes. This antibody has been extensively tested and validated for its ability to neutralize the activity of PYK2, making it an invaluable tool for researchers studying signal transduction pathways and cell signaling mechanisms. The PYK2 antibody can be used in a variety of applications, including Western blotting, immunoprecipitation, immunofluorescence, and flow cytometry. It is available as both a purified monoclonal antibody and as part of a kit that includes all the necessary reagents for successful experiments. With its high specificity and sensitivity, the PYK2 antibody is an essential tool for any researcher working with PYK2-related studies.

The TPM2 antibody is a highly specialized protein kinase that plays a crucial role in various biological processes. It belongs to the family of polyclonal antibodies and is widely used in life sciences research. This antibody specifically targets β-catenin, a key protein involved in cell adhesion and signaling pathways. By binding to β-catenin, the TPM2 antibody can modulate its activity and regulate downstream cellular processes.

The PSAP antibody is a growth factor antigen that plays a crucial role in various biological processes. It is an essential tool in the field of Life Sciences, particularly in antibody research. The PSAP antibody is available in both polyclonal and monoclonal forms, providing researchers with options to suit their specific needs.

The PARP2 antibody is a cytotoxic monoclonal antibody used in Life Sciences research. It is designed to target and bind to the PARP2 protein, which plays a crucial role in DNA repair and cell survival. This antibody can be immobilized on an electrode or used in various assays to study the interaction between PARP2 and other molecules.

Mouse monoclonal DNAJA2 antibody

Mouse monoclonal alpha Tubulin antibody (biotin)

HS3ST6 antibody was raised using a synthetic peptide corresponding to a region with amino acids GERLVSDPAGEVGRVQDFLGLKRVVTDKHFYFNATKGFPCLKKAQGGSRP

Methamphetamine antibody was raised in mouse using methamphetamine-BSA as the immunogen.

Goat anti Human IgE antibody

CD117 antibody (Spectral Red) was raised in rat using murine CD117/c-Kit as the immunogen.

CD38 antibody (PE) was raised in rat using CD38 as the immunogen.

Rabbit polyclonal NPEPL1 antibody

Donkey anti-sheep IgG (H + L) (FITC) was raised in donkey using sheep IgG (H&L) as the immunogen.

Rabbit polyclonal PLCL2 antibody

Rabbit polyclonal c-Rel antibody

UCHL5IP antibody was raised using the middle region of UCHL5IP corresponding to a region with amino acids LLDTIRSLTIGCSSCSSLMEHFEDTREKNEALLGELFSSPHLQMLLNPEC