Anticorps primaires
Sous-catégories appartenant à la catégorie "Anticorps primaires"
- Anticorps pour la recherche sur le cancer(3.620 produits)
- Anticorps cardio-vasculaires(2 produits)
- Biologie du développement(751 produits)
- Anticorps relatifs à l’épigénétique(162 produits)
- Anticorps d'immunologie(2.551 produits)
- Anticorps du métabolisme(279 produits)
- Anticorps de microbiologie(739 produits)
- Transduction du signal(2.717 produits)
- Tags & Marqueurs cellulaires(33 produits)
75447 produits trouvés pour "Anticorps primaires"
Rabbit anti Mouse IgM
Rabbit anti Mouse IgM is a monoclonal antibody that belongs to the category of antibodies. It is specifically designed to target and bind to mouse IgM, making it an essential tool for various research applications in the field of Life Sciences. This antibody can be used for studying the role of IgM in different biological processes such as anti-VEGF (vascular endothelial growth factor) therapy, adiponectin signaling, β-catenin regulation, and more. Additionally, Rabbit anti Mouse IgM can be utilized for detecting specific proteins like human chorionic gonadotropin (hCG), alpha-synuclein, epidermal growth factor (EGF), c-myc, and glycopeptides. Its binding ability allows researchers to explore these proteins' functions and interactions within cellular pathways. Furthermore, this antibody has been shown to induce Fas-mediated apoptosis in certain experimental settings. With its high specificity and versatility, Rabbit anti Mouse IgM is an invaluable tool for advancing scientific
Degré de pureté :Min. 95%beta Amyloid antibody
The beta Amyloid antibody is a powerful tool in the field of Life Sciences. It is a polyclonal antibody that specifically targets the amyloid protein, which is associated with various neurodegenerative disorders such as Alzheimer's disease. This antibody has been extensively tested and validated for use in immunoassays, making it an essential component in research and diagnostic applications.
PARD6A antibody
PARD6A antibody was raised using a synthetic peptide corresponding to a region with amino acids MARPQRTPARSPDSIVEVKSKFDAEFRRFALPRASVSGFQEFSRLLRAVH
RAP1GDS1 antibody
The RAP1GDS1 antibody is a monoclonal antibody that specifically targets annexin A2. It is widely used in Life Sciences research for various applications, including immunohistochemistry, Western blotting, and flow cytometry. Annexin A2 plays a crucial role in cell signaling pathways, particularly those involving epidermal growth factor (EGF), low-density lipoprotein (LDL) receptor-related protein 1 (LRP1), basic protein (BP), collagen, endothelial growth factor (EGF), and transforming growth factor-beta (TGF-beta). This antibody allows researchers to study the expression and localization of annexin A2 in different cell types and tissues. With its high specificity and sensitivity, the RAP1GDS1 antibody is an invaluable tool for understanding the functions of annexin A2 in cellular processes and disease mechanisms.
EGFR antibody
The EGFR antibody is a highly effective growth factor that targets the c-myc protein. It is available in both polyclonal and monoclonal forms, offering versatility in its applications. This cytotoxic antibody has been extensively studied and proven to be effective in various assays, including the inhibition of human chorionic gonadotropin (hCG) and anti-VEGF assays. The EGFR antibody specifically targets nuclear glycoproteins, making it an ideal choice for research involving inhibitors and other nuclear-related studies. With its high specificity and potency, this monoclonal antibody is a valuable tool for researchers in the field of molecular biology and beyond.
PACAP antibody
The PACAP antibody is a proteolytic monoclonal antibody that targets the cyclase-activating peptide (PACAP). It has been shown to exhibit cell cytotoxicity by binding to the conformational epitope of PACAP. This antibody can be used in various applications in the field of Life Sciences, including research on growth factors and as a vaccine adjuvant composition. The PACAP antibody specifically recognizes and binds to PACAP, which is involved in numerous biological processes such as glutamate release and regulation of hormone secretion. Additionally, this antibody has been used in hybridization studies to investigate the expression pattern of PACAP in different tissues. Its ability to modulate cyclase activation makes it a valuable tool for studying signaling pathways mediated by PACAP and its interaction with other molecules such as epidermal growth factor.
NMDAR1 antibody
The NMDAR1 antibody is a monoclonal antibody that targets the N-methyl-D-aspartate receptor subtype 1 (NMDAR1). This receptor is involved in various physiological processes, including synaptic plasticity and learning. The NMDAR1 antibody has been shown to inhibit the activation of NMDAR1 and reduce microvessel density in tumors by blocking the binding of growth factors to their receptors. It has also been demonstrated to modulate the expression of histidine, epidermal growth factor, and steroid receptors in granulosa cells. In addition, this antibody can activate e-cadherin and β-catenin signaling pathways, which are important for cell adhesion and migration. Overall, the NMDAR1 antibody offers promising applications in life sciences research and provides valuable insights into cellular mechanisms related to growth and development.
DSG3 antibody
DSG3 antibody is a monoclonal antibody used in the field of Life Sciences as an important tool for research and development. It specifically targets the desmoglein 3 protein, which is involved in cell adhesion and plays a crucial role in various physiological processes. The DSG3 antibody can be used to study the function of this protein, investigate its interactions with other molecules such as growth factors or oncolytic adenoviruses, and explore its potential as a therapeutic target.
SOX4 antibody
SOX4 antibody was raised in rabbit using the N terminal of SOX4 as the immunogen
Degré de pureté :Min. 95%ADA antibody
ADA antibody was raised using the middle region of ADA corresponding to a region with amino acids ANYSLNTDDPLIFKSTLDTDYQMTKRDMGFTEEEFKRLNINAAKSSFLPEDegré de pureté :Min. 95%PIB5PA antibody
PIB5PA antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.
Degré de pureté :Min. 95%GADD45A antibody
GADD45A antibody was raised in rabbit using the C terminal of GADD45A as the immunogen
Dengue Virus Type 1 Envelope Antigen, Recombinant
Please enquire for more information about Dengue Virus Type 1 Envelope Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page
Degré de pureté :Min. 95%Denosumab
CAS :Monoclonal antibody against RANKL; anti-resorptive agent for osteoperosis treatment
Degré de pureté :(Sec-Hplc) Min. 95 Area-%Couleur et forme :Clear LiquidCA 125 antibody (biotin)
CA 125 antibody (biotin) was raised in mouse using affinity pure human CA 125 antigen as the immunogen.
