Anticorps primaires

Affinity purified Rabbit polyclonal RIC8A antibody

Affinity purified Rabbit polyclonal CAPZB antibody

The VAV1 antibody is a highly specialized polyclonal antibody that targets the VAV1 protein. This protein plays a crucial role in endothelial growth and has been implicated in various biological processes. The VAV1 antibody is available as both polyclonal and monoclonal antibodies, allowing for versatile applications in life sciences research.

Rabbit polyclonal MTR1A antibody

OXTR antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.

Affinity purified Rabbit polyclonal AHI1 antibody

The LBP antibody is a monoclonal antibody that targets sumoylation, interleukins, and inhibitors. It is widely used in the field of Life Sciences for various applications. This antibody specifically recognizes and binds to tyrosine residues on proteins, including interferon-gamma and growth factors. It can be used for immunohistochemistry, western blotting, and other protein detection methods. The LBP antibody is also available as polyclonal antibodies and recombinant proteins for different research needs. With its high specificity and sensitivity, this antibody is an essential tool for studying protein interactions, signal transduction pathways, and diseases such as alpha-synuclein-related disorders.

The CD105 antibody is a monoclonal antibody that is used in various applications related to angiogenesis and antiangiogenic therapy. It specifically targets CD105, also known as endoglin, which is a marker for microvessel density. The CD105 antibody works by binding to the antigen and forming an antigen-antibody complex, which can be detected using different techniques such as fluorescence immunochromatography or polymerase chain reaction (PCR). This specific antibody has been shown to be effective in detecting angiogenic factors and autoantibodies in human serum samples. Its high specificity and sensitivity make it a valuable tool for research and clinical diagnostics.

CALN1 antibody was raised in Rabbit using Human CALN1 as the immunogen

DLAT antibody was raised in Rabbit using Human DLAT as the immunogen

EFNA4 antibody was raised in rabbit using the N terminal of EFNA4 as the immunogen

The SAMHD1 antibody is a highly specialized tool used in various assays and research applications. It specifically targets SAMHD1, an EGF-like glycoprotein involved in cellular processes. This antibody is designed to inhibit the activity of SAMHD1 and can be used as a valuable tool for studying its function.

SCYL3 antibody was raised using a synthetic peptide corresponding to a region with amino acids MGSENSALKSYTLREPPFTLPSGLAVYPAVLQDGKFASVFVYKRENEDKV

FCAR antibody was raised in Rabbit using Human FCAR as the immunogen

ITGA5 antibody was raised in Rabbit using Human ITGA5 as the immunogen

Rabbit polyclonal Ephrin A4 antibody

Affinity purified Rabbit polyclonal Unc182 antibody

Mouse monoclonal Influenza A haemagglutinin H1 antibody

TAPBP antibody was raised using a synthetic peptide corresponding to a region with amino acids GEAPPELLCLVSHFYPSGGLEVEWELRGGPGGRSQKAEGQRWLSALRHHS

The Fibrinogen antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It is designed to specifically target and bind to fibrinogen, a glycoprotein involved in blood clot formation. This antibody has been extensively studied and has shown great potential in various research applications.

The LOX antibody is a growth factor that belongs to the glycoprotein family. It is widely used in Life Sciences research for its ability to inhibit phosphatase activity. This monoclonal antibody can be used in various applications, such as Western blotting, immunohistochemistry, and flow cytometry. The LOX antibody specifically targets human serum and has been shown to interact with fibronectin, collagen, alpha-fetoprotein, dopamine, and other proteins. Its high specificity and affinity make it an excellent tool for studying the role of LOX in various biological processes. Whether you're investigating cancer development or tissue remodeling, the LOX antibody is a valuable asset in your research arsenal.

CA8 antibody was raised in Rabbit using Human CA8 as the immunogen

The DDC antibody is a powerful tool in the field of Life Sciences. It is an antibody that can be used for various applications, including research and diagnostic purposes. This antibody is highly specific and can recognize and bind to a target protein called DDC (dopa decarboxylase). DDC is an enzyme that plays a crucial role in the synthesis of important neurotransmitters like dopamine.

Rabbit polyclonal Caspase 8 antibody (Ser347)

Rabbit polyclonal STYK1 antibody

The PAX6 antibody is a growth factor that belongs to the class of monoclonal antibodies. It is designed to target and neutralize the PAX6 protein, which plays a crucial role in various biological processes. This antibody has been extensively studied and validated in Life Sciences research, making it a reliable tool for scientists and researchers. It can be used in experiments involving adipose tissue, nuclear signaling pathways, and other cellular processes where PAX6 is involved. The PAX6 antibody is also available as polyclonal antibodies for different applications, including the detection of chemokines, angptl3 inhibitors, and alpha-fetoprotein. With its high specificity and effectiveness, this antibody is an essential tool for studying PAX6-related mechanisms and exploring their potential therapeutic applications.

ACAD9 antibody was raised in Rabbit using Human ACAD9 as the immunogen

Rabbit polyclonal SAT1 antibody (FITC)

Testosterone 19 antibody was raised in rabbit using testosterone-19-HSA as the immunogen.

CSH2 antibody was raised in Rabbit using Human CSH2 as the immunogen

Rabbit polyclonal TADA3L antibody

The Listeria antibody is a polyclonal antibody that is used in Life Sciences research. It is commonly used in assays to detect the presence of Listeria monocytogenes, a bacterium that can cause serious infections in humans. This antibody specifically binds to nuclear antigens expressed by Listeria, allowing for easy detection and identification. The Listeria antibody is highly specific and sensitive, making it an essential tool for researchers studying this pathogen. It can be used in various applications, including immunohistochemistry, Western blotting, and ELISA assays. With its high affinity and specificity, the Listeria antibody provides accurate and reliable results in detecting Listeria monocytogenes in samples such as human serum or colloidal suspensions. Researchers rely on this powerful tool to advance their understanding of Listeria infection and develop effective treatments.

LILRA4 antibody was raised in Rabbit using Human LILRA4 as the immunogen

Carbonyl Reductase 1 antibody was raised using the middle region of CBR1 corresponding to a region with amino acids AEVTMKTNFFGTRDVCTELLPLIKPQGRVVNVSSIMSVRALKSCSPELQQ

The Neuropsin antibody is a highly specialized product in the field of Life Sciences. It is designed to target and neutralize the activated form of Neuropsin, an enzyme involved in various physiological processes. This antibody has been shown to inhibit the activity of Neuropsin, which plays a crucial role in fatty acid metabolism and the regulation of inflammatory responses.

MAP3K15 antibody was raised using the middle region of MAP3K15 corresponding to a region with amino acids TLEQKTQELYHLQLKLKSNCITENPAGPYGQRTDKELIDWLRLQGADAKT

Monoclonal antibody against RANKL; anti-resorptive agent for osteoperosis treatment

Please enquire for more information about Dengue Virus Type 1 Envelope Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page

CA 125 antibody (biotin) was raised in mouse using affinity pure human CA 125 antigen as the immunogen.

Cortisol antibody was raised in mouse using cortisol-3 BSA as the immunogen.