CymitQuimica logo
Anticorps primaires

Anticorps primaires

Les anticorps primaires sont des immunoglobulines qui se lient spécifiquement à un antigène d'intérêt, permettant la détection et la quantification de protéines, peptides ou autres biomolécules. Ces anticorps sont des outils essentiels dans de nombreuses applications, notamment le Western blot, l'immunohistochimie et l'ELISA. Chez CymitQuimica, nous proposons une vaste sélection d'anticorps primaires de haute qualité, offrant spécificité et sensibilité pour divers besoins de recherche, notamment en cancérologie, immunologie et biologie cellulaire.

Sous-catégories appartenant à la catégorie "Anticorps primaires"

Affichez 1 plus de sous-catégories

75326 produits trouvés pour "Anticorps primaires"

Trier par

Degré de pureté (%)
0
100
|
0
|
50
|
90
|
95
|
100
produits par page.
  • RPC3 antibody


    <p>Rabbit polyclonal RPC3 antibody</p>

    Ref: 3D-70R-35952

    Produit arrêté
  • Akt antibody


    <p>Protein kinase B (also known as RAC-alpha serine/threonine-protein kinase: Atk) is a serum and glucocorticoid-regulated protein kinase with three highly homologous isoforms (Akt1, 2 and 3). Akt1 and Akt3 are the predominant isoforms expressed in the brain, whereas Akt2 is mainly expressed in skeletal muscle and embryonic brown fat. These proteins play major regulatory roles in a range of physiological processes including: growth, proliferation, cell survival, angiogenesis, metabolism and Akt is also considered a proto-oncogene.Dysregulation in the Akt pathway is frequently associated with diseases like cancer and diabetes; mutations in pathway components such as PI3K, PTEN, or Akt itself can result in enhanced cell survival, uncontrolled growth, and resistance to treatment in cancer, as well as impaired glucose uptake in diabetes. Given its central role in these processes, Akt is a primary target in therapeutic research focused on regulating growth and metabolism.</p>

    Ref: 3D-70R-35759

    Produit arrêté
  • GluR1 antibody


    <p>The GluR1 antibody is a polyclonal antibody that is used in Life Sciences research. It has been specifically designed to detect and bind to the GluR1 receptor, which is an ionotropic glutamate receptor involved in synaptic transmission. This antibody can be used in various applications, such as electrochemical impedance spectroscopy and transcription-polymerase chain reaction (PCR), to study the function and expression of the GluR1 receptor. Additionally, it can be used in agglutination assays to measure the interaction between the GluR1 receptor and other molecules, such as glycine or gamma-aminobutyric acid (GABA). The GluR1 antibody has high specificity and affinity for its target, making it a valuable tool for researchers studying neuronal signaling pathways and synaptic plasticity. Furthermore, this antibody has shown antioxidant activity and may have potential therapeutic applications in neurodegenerative diseases.</p>
    Degré de pureté :Min. 95%

    Ref: 3D-20R-2412

    Produit arrêté
  • MAP4K1 antibody


    <p>MAP4K1 antibody was raised using the N terminal of MAP4K1 corresponding to a region with amino acids VHPLRVLFLMTKSGYQPPRLKEKGKWSAAFHNFIKVTLTKSPKKRPSATK</p>

    Ref: 3D-70R-3666

    Produit arrêté
  • CHIA antibody


    <p>CHIA antibody was raised using the N terminal of CHIA corresponding to a region with amino acids MVSTPENRQTFITSVIKFLRQYEFDGLDFDWEYPGSRGSPPQDKHLFTVL</p>
    Degré de pureté :Min. 95%

    Ref: 3D-70R-5920

    Produit arrêté
  • CCDC16 antibody


    <p>CCDC16 antibody was raised in rabbit using the middle region of CCDC16 as the immunogen</p>
    Degré de pureté :Min. 95%

    Ref: 3D-20R-1104

    Produit arrêté
  • ABCF3 antibody


    <p>ABCF3 antibody was raised using a synthetic peptide corresponding to a region with amino acids DDLVEAVGELLQEVSGDSKDDAGIRAVCQRMYNTLRLAEPQSQGNSQVLL</p>
    Degré de pureté :Min. 95%

    Ref: 3D-70R-6278

    Produit arrêté
  • EGFR antibody


    <p>The EGFR antibody is a highly specific antibody that targets the epidermal growth factor receptor (EGFR). It is used in life sciences research to study the activation and function of EGFR in various biological processes. The antibody can be used for applications such as immunohistochemistry, western blotting, and enzyme-linked immunosorbent assays (ELISA). It recognizes both the activated and non-activated forms of EGFR and has been validated for use in human serum samples. The EGFR antibody is available in both polyclonal and monoclonal formats, providing researchers with options to suit their experimental needs. With its high specificity and sensitivity, this antibody is a valuable tool for studying the role of EGFR in cell signaling pathways, growth factor interactions, and disease mechanisms.</p>
    Degré de pureté :Min. 95%

    Ref: 3D-20R-2032

    Produit arrêté
  • Arpc4 antibody


    <p>Arpc4 antibody was raised in rabbit using the N terminal of Arpc4 as the immunogen</p>
    Degré de pureté :Min. 95%

    Ref: 3D-70R-7971

    Produit arrêté
  • NF kappaB p100 antibody


    <p>Purified Polyclonal NF kappaB p100 antibody</p>
  • Lamin A antibody


    <p>The Lamin A antibody is a highly specialized product in the field of Life Sciences. It is a monoclonal antibody that specifically targets the molecule known as Lamin A. This antibody has been extensively tested and proven to be effective in neutralizing Lamin A, which plays a crucial role in various cellular processes.</p>

    Ref: 3D-70R-34617

    Produit arrêté
  • cJun antibody


    <p>Rabbit polyclonal cJun antibody</p>

    Ref: 3D-70R-33510

    Produit arrêté
  • RANBP1 antibody


    <p>The RANBP1 antibody is a highly specialized monoclonal antibody that targets the RAN binding protein 1 (RANBP1). This antibody has been extensively studied in the field of Life Sciences and has shown significant potential in various areas.</p>

    Ref: 3D-70R-50307

    Produit arrêté
  • NEUROD1 antibody


    <p>NEUROD1 antibody was raised in Rabbit using Human NEUROD1 as the immunogen</p>

    Ref: 3D-70R-18851

    Produit arrêté
  • PKC theta antibody (Ser676)


    <p>Rabbit Polyclonal PKC theta antibody (Ser676)</p>

    Ref: 3D-70R-37350

    Produit arrêté
  • PUB72 antibody


    <p>Purified Rabbit polyclonal PUB72 antibody</p>
  • Butyrophilin antibody


    <p>Butyrophilin antibody was raised in Guinea Pig using Butyrophilin purified from bovine milk fat globule membrane as the immunogen.</p>
    Degré de pureté :Min. 95%

    Ref: 3D-20R-2588

    Produit arrêté
  • GLUR2 antibody (Ser880)


    <p>Rabbit polyclonal GLUR2 antibody (Ser880)</p>

    Ref: 3D-70R-34161

    Produit arrêté
  • PM20D1 antibody


    <p>The PM20D1 antibody is a specific antibody that targets the PM20D1 antigen. It is commonly used in Life Sciences research to study the role of PM20D1 in various biological processes. This antibody is particularly useful as a serum marker for detecting the presence of PM20D1 in biological samples. It can be used in techniques such as immunohistochemistry and Western blotting to visualize and quantify the expression of PM20D1. Additionally, this antibody can be used as a tool to investigate the potential therapeutic applications of PM20D1 inhibitors or as a diagnostic tool for detecting autoantibodies against PM20D1. Its high specificity and sensitivity make it an essential component in many research studies related to dopamine metabolism, zinc chelation, fetal hemoglobin regulation, and other areas of interest in the field of Life Sciences.</p>

    Ref: 3D-70R-36395

    Produit arrêté
  • RPN1 antibody


    <p>Rabbit polyclonal RPN1 antibody</p>

    Ref: 3D-70R-19993

    Produit arrêté
  • Histone H4 (tri methyl K20) Ab


    <p>Histone H4 (tri methyl K20) Monoclonal Antibody</p>

    Ref: 3D-10-3037

    Produit arrêté
  • Fibrinopeptide A antibody


    <p>Fibrinopeptide A antibody was raised in sheep using Synthetic Fibrinopeptide A 1-16 conjugated to carrier as the immunogen.</p>
    Degré de pureté :Min. 95%

    Ref: 3D-20R-1408

    Produit arrêté
  • TCP1 zeta antibody


    <p>Purified Polyclonal TCP1 zeta antibody</p>

    Ref: 3D-70R-49493

    Produit arrêté
  • RAB14 antibody


    <p>Purified Polyclonal RAB14 antibody</p>

    Ref: 3D-70R-51381

    Produit arrêté
  • CYP1A1 antibody


    <p>CYP1A1 antibody was raised using the middle region of CYP1A1 corresponding to a region with amino acids QLSDEKIINIVLDLFGAGFDTVTTAISWSLMYLVMNPRVQRKIQEELDTV</p>
    Degré de pureté :Min. 95%

    Ref: 3D-70R-7266

    Produit arrêté
  • Tetracycline antibody


    <p>The Tetracycline antibody is a highly specific monoclonal antibody that binds to tetracycline, a broad-spectrum antibiotic. This antibody has a high receptor binding affinity and can be used in various applications, such as polymerase chain reactions (PCR), immunohistochemistry, and Western blotting. It specifically targets tetracycline residues in biological samples, allowing for the detection and quantification of this antibiotic. In addition to its use in research, the Tetracycline antibody has potential applications in the field of medicine. It can be used to study the cellular localization of tetracycline within cells or tissues, providing valuable insights into its mechanism of action. Furthermore, this antibody can be utilized to investigate protein-protein interactions involving tetracycline or its derivatives. The Tetracycline antibody is produced using advanced techniques in monoclonal antibody production. It exhibits high specificity and sensitivity, ensuring reliable and accurate results. This antibody is compatible with various sample types, including</p>
    Degré de pureté :≥90%