Anticorps primaires
Sous-catégories appartenant à la catégorie "Anticorps primaires"
- Anticorps pour la recherche sur le cancer(3.620 produits)
- Anticorps cardio-vasculaires(2 produits)
- Biologie du développement(751 produits)
- Anticorps relatifs à l’épigénétique(162 produits)
- Anticorps d'immunologie(2.551 produits)
- Anticorps du métabolisme(279 produits)
- Anticorps de microbiologie(739 produits)
- Transduction du signal(2.717 produits)
- Tags & Marqueurs cellulaires(33 produits)
75447 produits trouvés pour "Anticorps primaires"
THC antibody
The THC antibody is a highly specialized detection method for delta-9-tetrahydrocannabinol (THC). It utilizes the polymerase chain reaction (PCR) technique to amplify and detect THC-specific DNA sequences. This antibody exhibits strong DNA binding activity, allowing for efficient detection of even trace amounts of THC in various samples. It has been extensively tested and validated in Life Sciences research, demonstrating its reliability and accuracy.HSL antibody
The HSL antibody is a highly effective monoclonal antibody that specifically targets alpha-synuclein, a protein associated with neurodegenerative diseases such as Parkinson's and Alzheimer's. This antibody has been shown to activate glucose transporters in cells, leading to increased energy metabolism and improved neuronal function. Additionally, the HSL antibody has cytotoxic properties against cancer cells expressing the CD20 antigen, making it a potential therapeutic option for certain types of lymphoma. This antibody also interacts with tyrosine kinases and mitogen-activated protein kinases, signaling pathways involved in cell growth and proliferation. With its high specificity and affinity, the HSL antibody is a valuable tool for researchers in the life sciences field studying protein localization, expression, and function.PECAM1 antibody
The PECAM1 antibody is a highly specialized antibody that targets the Platelet Endothelial Cell Adhesion Molecule-1 (PECAM1). It is commonly used in research and life sciences applications involving mesenchymal stem cells. This antibody comes in both polyclonal and monoclonal forms, offering researchers a wide range of options for their experiments.GPR171 antibody
The GPR171 antibody is a highly specialized polyclonal antibody that is designed to target and bind to the GPR171 receptor. This receptor is activated by progesterone, interferon, and growth hormone, making it an important target for research in the field of Life Sciences. The GPR171 antibody can be used in various applications such as immunoassays and neutralizing experiments. It is also compatible with aldehyde-based fixation methods, allowing for easy integration into existing research protocols. With its high specificity and affinity, this monoclonal antibody is an invaluable tool for scientists studying chemokine signaling pathways and steroid receptors.Leiomodin 1 antibody
Leiomodin 1 antibody was raised using a synthetic peptide corresponding to a region with amino acids SRVAKYRRQVSEDPDIDSLLETLSPEEMEELEKELDVVDPDGSVPVGLRQ
TRIM67 antibody
TRIM67 antibody was raised using the C terminal of TRIM67 corresponding to a region with amino acids GGVCKGATVGVLLDLNKHTLTFFINGQQQGPTAFSHVDGVFMPALSLNRNMER antibody
MER antibody was raised in Mouse using a purified recombinant fragment of MER expressed in E. coli as the immunogen.ARL6IP1 antibody
ARL6IP1 antibody was raised in rabbit using the C terminal of ARL6IP1 as the immunogenDOCK11 antibody
The DOCK11 antibody is a growth factor that plays a crucial role in various processes within the Life Sciences field. It is an essential component in cell antigen recognition and the production of antibodies. The DOCK11 antibody has been shown to inhibit the activity of protons, which are responsible for acidification and cellular damage. Additionally, it has been found to have inhibitory effects on interleukin-6, a cytokine involved in inflammation and immune response regulation.
LENG4 antibody
LENG4 antibody was raised using the C terminal Of Leng4 corresponding to a region with amino acids LSAYWHGLHPGYYLSFLTIPLCLAAEGRLESALRGRLSPGGQKAWDWVHW
Estrogen Receptor alpha antibody
The Estrogen Receptor alpha antibody is a highly specialized biomolecule used in the field of life sciences. It is a monoclonal antibody that specifically targets the estrogen receptor alpha, a nuclear receptor involved in various cellular processes. This antibody recognizes and binds to the antigen binding domain of the estrogen receptor alpha, allowing for precise detection and analysis.cMyc antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections, thanks to its bactericidal activity. This active compound works by inhibiting bacterial growth through binding to DNA-dependent RNA polymerase, preventing transcription and replication. Its efficacy has been demonstrated using a patch-clamp technique on human erythrocytes. The drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits their cell growth in culture.VDAC3 antibody
The VDAC3 antibody is a highly specialized molecule drug that plays a crucial role in various biological processes. It is commonly used in research and diagnostic applications to study the function and localization of the voltage-dependent anion channel 3 (VDAC3). This antibody has been extensively tested and validated for its specificity and sensitivity.
HOXB9 antibody
The HOXB9 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It is designed to specifically target and bind to the HOXB9 protein, which plays a crucial role in various cellular processes. This antibody is produced using state-of-the-art techniques and undergoes stringent quality control measures to ensure its efficacy and reliability.GFP antibody (biotin)
GFP antibody (biotin) was raised in goat using a GFP fusion protein corresponding to the full length amino acid sequence (246aa) derived from the jellyfish Aequorea victoria as the immunogen.
STAT5A antibody
The STAT5A antibody is a highly specialized antibody that targets and neutralizes the STAT5A protein. This protein plays a crucial role in various cellular processes, including cell growth, differentiation, and survival. By binding to the STAT5A protein, this antibody inhibits its activity and prevents it from initiating these cellular processes.Survivin antibody
The Survivin antibody is a highly specialized antibody used in Life Sciences research. It is a polyclonal antibody that has been developed to specifically target and bind to survivin, a protein involved in cell division and apoptosis regulation. This antibody can be used in various applications, including immunohistochemistry, Western blotting, and flow cytometry.Catenin antibody
Catenin antibody was raised using a synthetic peptide corresponding to a region with amino acids YPPDGYSRHYEDGYPGGSDNYGSLSRVTRIEERYRPSMEGYRAPSRQDVY
MRM1 antibody
MRM1 antibody was raised using a synthetic peptide corresponding to a region with amino acids GTVGCPSTEDPQSSEIPIMSCLEFLWERPTLLVLGNEGSGLSQEVQASCQNUDT9 antibody
NUDT9 antibody was raised using a synthetic peptide corresponding to a region with amino acids MSGSNGSKENSHNKARTSPYPGSKVERSQVPNEKVGWLVEWQDYKPVEYTGata4 antibody
The Gata4 antibody is a monoclonal antibody that specifically targets the Gata4 protein, which plays a crucial role in various biological processes. This antibody has been extensively tested and shown to be cytotoxic against cells expressing high levels of Gata4, making it a valuable tool for research and diagnostic applications. Additionally, the Gata4 antibody has been used in assays to study the interaction between Gata4 and other proteins, such as urokinase plasminogen activator. It has also been utilized in studies involving adipose tissue and its role in metabolism. This monoclonal antibody is highly specific and exhibits minimal cross-reactivity with other target molecules. With its exceptional binding affinity and selectivity, the Gata4 antibody is an essential tool for researchers studying various cellular processes and developing potential therapeutic inhibitors.
Nav1.7 antibody
The Nav1.7 antibody is a monoclonal antibody that targets the Nav1.7 channel, a key player in pain signaling. This antibody has been extensively studied for its potential therapeutic applications in pain management. It works by blocking the activity of the Nav1.7 channel, which reduces the transmission of pain signals to the brain.
Fibronectin 1 antibody
The Fibronectin 1 antibody is a monoclonal antibody used in Life Sciences for various applications. It is commonly used as a diagnostic reagent to detect the presence of fibronectin 1, a biomolecule involved in cell adhesion and migration. This antibody specifically binds to fibronectin 1 with high affinity and specificity, making it an ideal tool for research and diagnostic purposes.
HAT1 antibody
The HAT1 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It is specifically designed to target and inhibit the activity of the HAT1 enzyme, which plays a crucial role in various cellular processes. This antibody has been extensively tested and validated for its efficacy in blocking HAT1 activity in nuclear and adipose tissues.LOC339879 antibody
LOC339879 antibody was raised using the C terminal of LOC339879 corresponding to a region with amino acids HELVKHEENGLVFEDSEELAAQLQMLFSNFPDPAGKLNQFRKNLQESQQLHSP60 antibody
HSP60 antibody was raised in mouse using recombinant human Hsp60 (1-573aa) purified from E. coli as the immunogen.
FBXO25 antibody
FBXO25 antibody was raised using the C terminal of FBXO25 corresponding to a region with amino acids AKEQYGDTLHFCRHCSILFWKDSGHPCTAADPDSCFTPVSPQHFIDLFKFID2 antibody
The ID2 antibody is a monoclonal antibody that has a high affinity for various proteins, including serum albumin, alpha-fetoprotein, collagen, fibronectin, and erythropoietin. This antibody is widely used in the field of Life Sciences for research purposes. It can be utilized to study protein-protein interactions, as well as to detect the presence of specific proteins in samples. The ID2 antibody has been shown to inhibit the growth of endothelial cells by blocking the activity of certain growth factors. It also plays a role in regulating the glycosylation process and interferon signaling pathways. This antibody is particularly useful in studies related to human serum, androgen metabolism, low-density lipoprotein metabolism, and cancer research. With its versatility and specificity, the ID2 antibody is an invaluable tool for researchers in various fields.GST antibody
GST antibody was raised in mouse using recombinant Glutathione S transferase (GST) purified from E. coli as the immunogen.hCG beta antibody
The hCG beta antibody is a protein that belongs to the Life Sciences category. It functions by binding to the nuclear factor kappa-light-chain-enhancer in order to regulate gene expression. This antibody is commonly used in research and diagnostic applications, particularly in the field of reproductive health. It has been shown to interact with various proteins, including mitogen-activated protein and β-catenin, which are involved in cellular signaling pathways. Additionally, this antibody has been found to have an inhibitory effect on the activity of p38 mitogen-activated protein phosphatase and caspase-9, both of which play important roles in cell growth and apoptosis. The hCG beta antibody is available as a monoclonal antibody, making it highly specific and reliable for use in experiments and assays requiring precise detection and analysis of target molecules.
RSAD2 antibody
RSAD2 antibody was raised using the C terminal of RSAD2 corresponding to a region with amino acids YLILDEYMRFLNCRKGRKDPSKSILDVGVEEAIKFSGFDEKMFLKRGGKYMDM4 antibody
MDM4 antibody was raised in Mouse using a purified recombinant fragment of human MDM4 expressed in E. coli as the immunogen.TSGA13 antibody
TSGA13 antibody was raised using the middle region of TSGA13 corresponding to a region with amino acids ASERPISKVIREPLTLASLLEDMPTRTAPGESAFRNGRAPQWIIKKATVI
MIF antibody
The MIF antibody is a highly effective inhibitor that targets the polymers of macrophage migration inhibitory factor (MIF). This monoclonal antibody has neutralizing properties and is specifically designed to block the activity of MIF. It has been extensively used in Life Sciences research, particularly in studies related to annexin A2 and chemokine regulation. The MIF antibody can be used in various experimental techniques, including Western blotting, immunohistochemistry, and flow cytometry. Its high affinity for MIF makes it a valuable tool for researchers studying cardiomyocyte function and investigating the role of MIF in different biological processes. When combined with streptavidin or other detection systems, this monoclonal antibody provides reliable and accurate results. Choose the MIF antibody for your research needs and unlock new insights into the intricate mechanisms of cellular signaling pathways.ALDH1A1 antibody
ALDH1A1 antibody was raised using the middle region of ALDH1A1 corresponding to a region with amino acids SVERAKKYILGNPLTPGVTQGPQIDKEQYDKILDLIESGKKEGAKLECGGRanGAP1 antibody
The RanGAP1 antibody is a highly specialized protein complex that plays a crucial role in various biological processes. It acts as a regulator for the transport of biomolecules between the nucleus and cytoplasm, ensuring proper cellular function. This antibody has been extensively studied for its potential therapeutic applications, particularly in the field of oncology.
VCP antibody
The VCP antibody is an inhibitory factor that targets insulin and other growth factors. This acidic antibody has been shown to inhibit the activity of insulin and epidermal growth factor, preventing their binding to their respective receptors. Additionally, the VCP antibody has cytotoxic effects on cells expressing collagen and fibronectin, making it a potential therapeutic option for diseases involving excessive collagen production. This monoclonal antibody is widely used in Life Sciences research and has also been studied as a potential treatment for autoimmune disorders due to its ability to target autoantibodies. The VCP antibody shows promise in combination with other antibodies such as trastuzumab, an anti-HER2 antibody, in inhibiting tumor growth by blocking growth factor signaling pathways.
CSTF3 antibody
CSTF3 antibody was raised using the middle region of CSTF3 corresponding to a region with amino acids FEELKKHEDSAIPRRLECLKEDVQRQQEREKELQHRYADLLLEKETLKSK
CD31 antibody
The CD31 antibody is a monoclonal antibody that is commonly used in life sciences research. It is designed to specifically bind to CD31, a protein that is expressed on the surface of activated tyrosine kinase receptors. This antibody can be used in various assays and experiments to study the function and activity of these receptors.E2F4 antibody
The E2F4 antibody is a highly specialized protein molecule drug used in Life Sciences. It belongs to the class of monoclonal antibodies and possesses neutralizing properties. This antibody specifically targets E2F4, a protein involved in cell cycle regulation and DNA replication. By binding to E2F4, this antibody prevents its activity and inhibits cell division.Amphiphysin antibody
The Amphiphysin antibody is a powerful tool used in the field of Life Sciences. This antibody plays a crucial role in various biological processes, including interferon signaling and fas-mediated apoptosis. It is also involved in the production of autoantibodies, collagen synthesis, glycosylation, and fibroin formation.
Otospiralin antibody
Otospiralin antibody was raised using the N terminal of OTOS corresponding to a region with amino acids MQACMVPGLALCLLLGPLAGAKPVQEEGDPYAELPAMPYWPFSTSDFWNYPFKL antibody
The PFKL antibody is a highly specialized biomolecule that plays a crucial role in various biological processes. It acts as a chemokine and growth factor, regulating cell migration, proliferation, and differentiation. This antibody has been extensively studied in the context of pleural fluid and human serum, where it has been shown to interact with specific binding proteins.SUV39H2 antibody
SUV39H2 antibody was raised using a synthetic peptide corresponding to a region with amino acids LDTRLPRIALFSTRTINAGEELTFDYQMKGSGDISSDSIDHSPAKKRVRTCD122 antibody
The CD122 antibody is a highly specialized monoclonal antibody that targets TGF-beta, a low-molecular-weight cytokine involved in cell growth and immune response regulation. This antibody has cytotoxic properties and can be used for various applications in the field of life sciences. It can be immobilized on streptavidin-coated surfaces to study the interaction between TGF-beta and other molecules such as epidermal growth factor (EGF), transferrin, or growth factors with EGF-like domains. The CD122 antibody also has neutralizing capabilities, making it ideal for blocking the biological activity of TGF-beta. It is available as both polyclonal and monoclonal antibodies and can be used in research involving human serum samples. With its versatility and specificity, the CD122 antibody is an essential tool for researchers in the life sciences field.C1 inhibitor antibody
The C1 inhibitor antibody is a powerful tool used in Life Sciences research. This antibody specifically targets and binds to the C1 inhibitor protein, which plays a crucial role in regulating the complement system. Autoantibodies against the C1 inhibitor can lead to various autoimmune diseases, making this antibody an essential tool for studying these conditions.
WDR4 antibody
WDR4 antibody was raised using the N terminal of WDR4 corresponding to a region with amino acids FIYDCSAAEKKSQENKGEDAPLDQGSGAILASTFSKSGSYFALTDDSKRLPGAM1 antibody
The PGAM1 antibody is a specific antibody that is commonly used in research involving pluripotent stem cells. It plays a crucial role in various assays and experiments related to the field of Life Sciences. This antibody specifically targets and interacts with PGAM1, which is an enzyme involved in the glycolysis pathway. By inhibiting or modulating the activity of PGAM1, researchers can gain insights into its function and potential therapeutic applications.
