Anticorps primaires

Affinity purified Rabbit polyclonal SCN1B antibody

Affinity purified Rabbit polyclonal VPS37C antibody

The NOX1 antibody is a highly specialized polyclonal antibody that targets the oncostatin receptor. It is designed to specifically bind to glial fibrillary acidic protein (GFAP), an antigen expressed in glial cells. This antibody can be used for various applications, including immunohistochemistry and western blotting, to detect the presence and localization of GFAP in tissues or cell cultures.

Affinity purified Rabbit polyclonal Phospho-ORF50 antibody

FBXL20 antibody was raised in rabbit using the middle region of FBXL20 as the immunogen

Rabbit polyclonal IKK alpha/beta antibody for detection of the Phospho-Ser176 form of the IKK alpha/beta peptide.

BTK antibody was raised in Mouse using a purified recombinant fragment of BTK expressed in E. coli as the immunogen.

Affinity purified Rabbit polyclonal PRNP antibody

NEFL antibody was raised in Rabbit using Human NEFL as the immunogen

Affinity purified Rabbit polyclonal UGT1A9 antibody

ACSL1 antibody was raised in Rabbit using Human ACSL1 as the immunogen

Affinity purified Rabbit polyclonal SRPX antibody

CD71 antibody (Azide free) was raised in rat using CD71/transferrin receptor as the immunogen.

The OR51E2 antibody is a highly specialized monoclonal antibody that is used in various Life Sciences applications. This antibody specifically targets and interacts with the OR51E2 protein, which plays a crucial role in cellular processes such as cell growth, proliferation, and differentiation.

ANXA3 antibody was raised in Rabbit using Human ANXA3 as the immunogen

Rabbit polyclonal AP2M1 antibody (biotin)

Affinity purified Rabbit polyclonal Cryopyrin antibody

Rabbit polyclonal Cathepsin F antibody (HRP)

Sheep polyclonal DNM1 antibody (Ser778)

The VDAC1 antibody is a specific monoclonal antibody that is used as a molecular drug in the field of Life Sciences. It has been extensively studied for its ability to target and neutralize antiphospholipid antibodies, which are known to have procoagulant and anticoagulant effects. The VDAC1 antibody has also been shown to inhibit protein kinase activity and regulate fatty acid metabolism. It is commonly used in research studies involving insulin signaling pathways and the modulation of cellular processes. Additionally, this antibody has been investigated for its potential therapeutic applications in various fields, including the treatment of mesenchymal stem cells and the development of novel oral contraceptives. Its high specificity and effectiveness make it a valuable tool for researchers in the Life Sciences field.

RAD23A antibody was raised using a synthetic peptide corresponding to a region with amino acids  GIPGSPEPEHGSVQESQVSEQPATEAAGENPLEFLRDQPQFQNMRQVIQQ

The MAG antibody is a highly specialized antibody that has various characteristics and applications. It is a DNA aptamer that acts as an active agent, capable of neutralizing the effects of SN-38, a potent cytotoxic compound. The MAG antibody can be used in various research and diagnostic applications due to its specificity and binding affinity.

The CD2 antibody is a monoclonal antibody that targets the CD2 protein, which plays a crucial role in T-cell activation and growth factor signaling. This antibody specifically binds to the activated form of CD2 and has been shown to inhibit T-cell proliferation and cytokine production. Additionally, it has hypomethylating properties, which may contribute to its anti-inflammatory effects. The CD2 antibody is commonly used in Life Sciences research for studying T-cell biology and immune responses. It can also be used in combination with other antibodies or inhibitors for antibody-drug conjugate therapy. Furthermore, this antibody has been utilized in various studies involving extracellular histones, tyrosine kinase inhibitors like imatinib, and intracellular signaling pathways such as p38 MAPK. Its versatility and specificity make it an invaluable tool for researchers in the field of immunology.

CRP antibody was raised using the N terminal of CRP corresponding to a region with amino acids MEKLLCFLVLTSLSHAFGQTDMSRKAFVFPKESDTSYVSLKAPLTKPLKA

HCCS antibody was raised in rabbit using the C terminal of HCCS as the immunogen

GAMT antibody was raised in Rabbit using Human GAMT as the immunogen

BRAF antibody was raised in Mouse using a purified recombinant fragment of human BRAF expressed in E. coli as the immunogen.

The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections as it exhibits bactericidal activity. By binding to DNA-dependent RNA polymerase, this drug inhibits bacterial growth by preventing transcription and replication. Its potency has been demonstrated through a patch-clamp technique on human erythrocytes. The active form of this drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits their cell growth in culture.

Goat polyclonal AFP antibody (Fab'2)

Affinity purified Rabbit polyclonal MYO1B antibody

Affinity purified Rabbit polyclonal HICE1 antibody

Rabbit polyclonal RPL5 antibody

CD40LG antibody was raised in Rabbit using Human CD40LG as the immunogen

NFE2L1 antibody was raised in Rabbit using Human NFE2L1 as the immunogen

TCHP antibody was raised in rabbit using the C terminal of TCHP as the immunogen

PYGO1 antibody was raised in rabbit using the middle region of PYGO1 as the immunogen

ZHX2 antibody was raised in rabbit using the C terminal of ZHX2 as the immunogen

Please enquire for more information about HBsAg Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page

Please enquire for more information about Dengue Virus Type 1 Envelope Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page

Monoclonal antibody against RANKL; anti-resorptive agent for osteoperosis treatment

CA 125 antibody (biotin) was raised in mouse using affinity pure human CA 125 antigen as the immunogen.

Cortisol antibody was raised in mouse using cortisol-3 BSA as the immunogen.