CymitQuimica logo
Anticorps primaires

Anticorps primaires

Les anticorps primaires sont des immunoglobulines qui se lient spécifiquement à un antigène d'intérêt, permettant la détection et la quantification de protéines, peptides ou autres biomolécules. Ces anticorps sont des outils essentiels dans de nombreuses applications, notamment le Western blot, l'immunohistochimie et l'ELISA. Chez CymitQuimica, nous proposons une vaste sélection d'anticorps primaires de haute qualité, offrant spécificité et sensibilité pour divers besoins de recherche, notamment en cancérologie, immunologie et biologie cellulaire.

Sous-catégories appartenant à la catégorie "Anticorps primaires"

Affichez 1 plus de sous-catégories

75326 produits trouvés pour "Anticorps primaires"

Trier par

Degré de pureté (%)
0
100
|
0
|
50
|
90
|
95
|
100
produits par page.
  • MRPL4 antibody


    <p>Rabbit polyclonal MRPL4 antibody</p>

    Ref: 3D-70R-36074

    Produit arrêté
  • SLC24A1 antibody


    <p>SLC24A1 antibody was raised using a synthetic peptide corresponding to a region with amino acids EQLSRRPVAKVMALEDLSKPGDGAIAVDELQDNKKLKLPSLLTRGSSSTS</p>
    Degré de pureté :Min. 95%
  • DULLARD antibody


    <p>DULLARD antibody was raised using a synthetic peptide corresponding to a region with amino acids HPDNAIPIKSWFSDPSDTALLNLLPMLDALRFTADVRSVLSRNLHQHRLW</p>
    Degré de pureté :Min. 95%

    Ref: 3D-70R-6260

    Produit arrêté
  • ARPC2 antibody


    <p>ARPC2 antibody was raised in Rabbit using Human ARPC2 as the immunogen</p>

    Ref: 3D-70R-15843

    Produit arrêté
  • Tetanus toxin antibody


    <p>Tetanus toxin antibody is a monoclonal antibody that specifically targets and neutralizes the tetanus toxin. This antibody is derived from alpha-fetoprotein and has been extensively studied in the field of Life Sciences. It binds to the tetanus toxin, preventing it from binding to its target receptors and exerting its toxic effects. Additionally, this antibody has been shown to inhibit the activity of TGF-beta, a growth factor involved in various cellular processes. The binding proteins present in this antibody can effectively block the interaction between TGF-beta and its receptors, leading to the inhibition of downstream signaling pathways. Furthermore, studies have demonstrated that this monoclonal antibody can also bind to autoantibodies and other proteins involved in disease progression. With its high specificity and efficacy, tetanus toxin antibody holds great potential for therapeutic applications in various medical conditions.</p>

    Ref: 3D-10-1559

    Produit arrêté
  • CD56 antibody


    <p>CD56 antibody is a monoclonal antibody that specifically targets CD56, a cell surface protein found on various immune cells. This antibody can be used in immunohistochemistry and flow cytometry to detect and quantify CD56 expression. It is commonly used in research and diagnostic applications related to the study of immune cell function and diseases such as cancer. CD56 antibody works by binding to the CD56 protein, allowing for visualization and analysis of CD56-positive cells. It is highly specific and sensitive, making it a valuable tool in life sciences research.</p>
    Degré de pureté :Min. 95%

    Ref: 3D-70R-51599

    Produit arrêté
  • KCNG1 antibody


    <p>KCNG1 antibody was raised using the N terminal of KCNG1 corresponding to a region with amino acids MTLLPGDNSDYDYSALSCTSDASFHPAFLPQRQAIKGAFYRRAQRLRPQD</p>

    Ref: 3D-70R-5115

    Produit arrêté
  • SET antibody


    <p>The SET antibody is a highly specialized monoclonal antibody that has been developed for use in the field of Life Sciences. This antibody specifically targets and neutralizes the activity of SET, a protein that plays a crucial role in various cellular processes such as interferon response, cell growth, and angiogenesis.</p>

    Ref: 3D-70R-20188

    Produit arrêté
  • PDE4B antibody


    <p>Mouse monoclonal PDE4B antibody</p>

    Ref: 3D-10R-5199

    Produit arrêté
  • RSU1 antibody


    <p>Rabbit polyclonal RSU1 antibody</p>
  • GARS antibody


    <p>Mouse monoclonal anti human GARS antibody</p>

    Ref: 3D-10R-11289

    Produit arrêté
  • HUS1B antibody


    <p>HUS1B antibody was raised using a synthetic peptide corresponding to a region with amino acids ELFIHVSGTVARLAKVCVLRVRPDSLCFGPAGSGGLHEARLWCEVRQGAF</p>

    Ref: 3D-70R-2339

    Produit arrêté
  • HIV1 gp41 antibody (biotin)


    <p>Mouse monoclonal HIV1 gp41 antibody (biotin); Neat Serum with no preservatives.</p>

    Ref: 3D-61-002305

    Produit arrêté
  • PTK6 antibody


    <p>Rabbit polyclonal PTK6 antibody</p>

    Ref: 3D-70R-19632

    Produit arrêté
  • UROD antibody


    <p>The UROD antibody is a highly specialized monoclonal antibody that has neutralizing properties against annexin A2. This antibody is colloidal in nature and is used in Life Sciences research to study the role of annexin A2 in various cellular processes. It has been shown to inhibit the activity of glucagon, a hormone involved in glucose metabolism. The UROD antibody specifically targets the amino-terminal region of annexin A2, which is activated under certain conditions. This monoclonal antibody can be used in experiments to investigate the function of annexin A2 and its potential as a therapeutic target for various diseases, including cardiomyocyte dysfunction and natriuretic factor regulation. Additionally, polyclonal antibodies targeting annexin A2 are also available for research purposes.</p>

    Ref: 3D-70R-21183

    Produit arrêté
  • TOE1 antibody


    <p>TOE1 antibody was raised using a synthetic peptide corresponding to a region with amino acids VVDVQSNNFKEMWPSLLLAIKTANFVAVDTELSGLGDRKSLLNQCIEERY</p>

    Ref: 3D-70R-2907

    Produit arrêté
  • MZF1 antibody


    <p>The MZF1 antibody is a potent family kinase inhibitor that belongs to the class of antibodies. It specifically targets fibrinogen, a protein involved in blood clotting. This polyclonal antibody has been extensively studied and proven to be effective in inhibiting the activity of fibrinogen. It can be used in various applications in the field of Life Sciences, such as research on dopamine receptors and growth factors. Additionally, this monoclonal antibody has shown inhibitory effects on tyrosine kinases, which play a crucial role in cell signaling pathways. The MZF1 antibody is a valuable tool for scientists and researchers working in the fields of biology, medicine, and pharmacology. Its versatility and specificity make it an essential component in various experiments and studies.</p>

    Ref: 3D-70R-31666

    Produit arrêté
  • HAG2 antibody


    <p>Mouse monoclonal HAG2 antibody</p>

    Ref: 3D-10R-10321

    Produit arrêté
  • WASF3 antibody


    <p>WASF3 antibody was raised using the N terminal of WASF3 corresponding to a region with amino acids NMKKAFKSSTVQDQQVVSKNSIPNPVADIYNQSDKPPPLNILTPYRDDKK</p>
  • ITGA6 antibody


    <p>The ITGA6 antibody is a powerful tool in the field of Life Sciences. It plays a crucial role in various biological processes, including adipose tissue development, dopamine signaling, and immune response. This monoclonal antibody specifically targets the integrin alpha 6 (ITGA6), which is a protein complex involved in cell adhesion and migration.</p>

    Ref: 3D-70R-21573

    Produit arrêté
  • MTHFD1 antibody


    <p>MTHFD1 antibody was raised using a synthetic peptide corresponding to a region with amino acids RTTTESEVMKYITSLNEDSTVHGFLVQLPLDSENSINTEEVINAIAPEKD</p>

    Ref: 3D-70R-2357

    Produit arrêté
  • PAK7 antibody


    <p>The PAK7 antibody is a highly specialized product in the field of Life Sciences. It is an anti-MERTK antibody that specifically targets and binds to the activated form of the MERTK protein. This antibody is designed to facilitate antigen-antibody reactions, making it an essential tool for various research applications.</p>

    Ref: 3D-70R-19100

    Produit arrêté
  • MEF2C antibody (Ser387)


    <p>Rabbit Polyclonal MEF2C antibody (Ser387)</p>

    Ref: 3D-70R-36732

    Produit arrêté
  • LIN7C antibody


    <p>LIN7C antibody was raised in Rabbit using Human LIN7C as the immunogen</p>

    Ref: 3D-70R-18280

    Produit arrêté
  • CCDC138 antibody


    <p>CCDC138 antibody was raised using the N terminal of CCDC138 corresponding to a region with amino acids EPRVVKPPGQDLVVESLKSRYGLGGSCPDEYDFSNFYQSKYKRRTLTSPG</p>

    Ref: 3D-70R-3552

    Produit arrêté
  • SPTLC1 antibody


    <p>SPTLC1 antibody was raised using the middle region of SPTLC1 corresponding to a region with amino acids  DLERLLKEQEIEDQKNPRKARVTRRFIVVEGLYMNTGTICPLPELVKLKY</p>
    Degré de pureté :Min. 95%