Anticorps primaires

<p>ACOT11 antibody was raised using the middle region of ACOT11 corresponding to a region with amino acids AEKTRVESVELVLPPHANHQGNTFGGQIMAWMENVATIAASRLCRAHPTL</p>

<p>C16ORF58 antibody was raised using the N terminal Of C16Orf58 corresponding to a region with amino acids QAVFLPQGFPDSVSPDYLPYQLWDSVQAFASSLSGSLATQAVLLGIGVGN</p>

<p>The ERCC1 antibody is a highly specialized monoclonal antibody that has cytotoxic properties. It is designed to specifically target and neutralize the alpha-fetoprotein, which is a protein associated with certain types of cancer. The antibody works by binding to the alpha-fetoprotein, preventing its interaction with other proteins and inhibiting its function.</p>

<p>Purified Polyclonal SSBP2 antibody</p>

<p>EIF3C antibody was raised in Rabbit using Human EIF3C as the immunogen</p>

<p>KCNA10 antibody was raised using the N terminal of KCNA10 corresponding to a region with amino acids DVCGWKEMEVALVNFDNSDEIQEEPGYATDFDSTSPKGRPGGSSFSNGKI</p>

<p>6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an antituberculosis drug belonging to the class of rifamycins. It is highly effective in treating tuberculosis infections. This active compound exhibits bactericidal activity by inhibiting bacterial growth through binding to DNA-dependent RNA polymerase, preventing transcription and replication. The effectiveness of this drug has been demonstrated through patch-clamp technique studies on human erythrocytes. Metabolically, it undergoes various transformations such as hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, 6-Fluoro-3-indoxyl-beta-D-galactopyranoside specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains, inhibiting their cell growth in culture.</p>

<p>Gnpda1 antibody was raised in rabbit using the N terminal of Gnpda1 as the immunogen</p>

<p>RAGE antibody was raised using the N terminal of RAGE corresponding to a region with amino acids MKQRFESIEQVNNLREIQALRRLNPHPNILMLHEVVFDRKSGSLALICEL</p>

<p>ETFB antibody was raised using the C terminal of ETFB corresponding to a region with amino acids TADLRLNEPRYATLPNIMKAKKKKIEVIKPGDLGVDLTSKLSVISVEDPP</p>

<p>Opticin antibody was raised using the C terminal of OPTC corresponding to a region with amino acids LSDNLLDSIPGPLPLSLRSVHLQNNLIETMQRDVFCDPEEHKHTRRQLED</p>

<p>FXR1 antibody was raised using the C terminal of FXR1 corresponding to a region with amino acids EQLRQIGSRSYSGRGRGRRGPNYTSGYGTNSELSNPSETESERKDELSDW</p>

<p>Purified Polyclonal CK1 gamma 2 antibody</p>

<p>HPV18 antibody was raised in mouse using papilloma virus type 18 as the immunogen.</p>

<p>SLC46A1 antibody was raised using a synthetic peptide corresponding to a region with amino acids  MEGSASPPEKPRARPAAAVLCRGPVEPLVFLANFALVLQGPLTTQYLWHR</p>

<p>Rabbit polyclonal TEX11 antibody</p>

<p>The Paxillin antibody is a powerful tool used in the field of Life Sciences. It is a monoclonal antibody that specifically targets and neutralizes paxillin, a protein involved in cell adhesion and migration. This antibody has been widely used in research to study various cellular processes, including growth factor signaling, chemokine-induced migration, lipoprotein lipase activity, TGF-beta signaling, and more. The Paxillin antibody has also shown cytotoxic effects on activated cells and has been used as a therapeutic agent in certain diseases. With its ability to specifically bind to paxillin and inhibit its function, this antibody has become an essential tool for scientists studying cell biology and related fields.</p>

<p>SLC22A7 antibody was raised using a synthetic peptide corresponding to a region with amino acids LSLPKLTYGGIALLAAGTALLLPETRQAQLPETIQDVERKSAPTSLQEEE</p>

<p>Carboxypeptidase B2 antibody was raised using a synthetic peptide corresponding to a region with amino acids RSKSKDHEELSLVASEAVRAIEKTSKNTRYTHGHGSETLYLAPGGGDDWI</p>

<p>LOC730950 antibody was raised in rabbit using the C terminal of LOC730950 as the immunogen</p>

<p>anti-Dog IgE Antibody</p>

<p>Rabbit polyclonal ERH antibody (biotin)</p>

<p>Rabbit polyclonal LMTK2 antibody</p>

<p>IKK-gamma antibody was raised in rabbit using residues 2-13 [NRHLWKSQLCEM] of the IKK-gamma protein as the immunogen.</p>

<p>The HSP27 antibody is a highly specialized tool used in Life Sciences research. It is designed to target and bind to the Heat Shock Protein 27 (HSP27), a protein involved in cellular stress response and regulation. This antibody can be used in various applications, such as immunohistochemistry, western blotting, and enzyme-linked immunosorbent assays (ELISA).</p>

<p>The Tetracycline antibody is a highly specific monoclonal antibody that binds to tetracycline, a broad-spectrum antibiotic. This antibody has a high receptor binding affinity and can be used in various applications, such as polymerase chain reactions (PCR), immunohistochemistry, and Western blotting. It specifically targets tetracycline residues in biological samples, allowing for the detection and quantification of this antibiotic. In addition to its use in research, the Tetracycline antibody has potential applications in the field of medicine. It can be used to study the cellular localization of tetracycline within cells or tissues, providing valuable insights into its mechanism of action. Furthermore, this antibody can be utilized to investigate protein-protein interactions involving tetracycline or its derivatives. The Tetracycline antibody is produced using advanced techniques in monoclonal antibody production. It exhibits high specificity and sensitivity, ensuring reliable and accurate results. This antibody is compatible with various sample types, including</p>