Anticorps primaires

<p>Rabbit polyclonal Smad2/3 antibody</p>

<p>Rabbit polyclonal EIF3K antibody</p>

<p>Rabbit polyclonal UBL4A antibody</p>

<p>FMNL1 antibody was raised in mouse using recombinant Human Formin-Like 1</p>

<p>SIRT5 antibody was raised using the C terminal of SIRT5 corresponding to a region with amino acids  HCDLCLVVGTSSVVYPAAMFAPQVAARGVPVAEFNTETTPATNRFSHLIS</p>

<p>SLFN12 antibody was raised using the middle region of SLFN12 corresponding to a region with amino acids KYLLKALFKALKRLKSLRDQFSFAENLYQIIGIDCFQKNDKKMFKSCRRL</p>

<p>Purified Rabbit polyclonal MYB33 antibody</p>

<p>Desmin antibody is a monoclonal antibody that specifically targets desmin, a protein found in muscle cells. This antibody is widely used in life sciences research to study the structure and function of muscle tissues. Desmin antibody can be used for various applications, including immunohistochemistry, western blotting, and flow cytometry. It has been shown to effectively detect desmin in different cell types, including MCF-7 cells. Additionally, this antibody has been used in studies investigating the role of desmin in various cellular processes, such as cell growth and differentiation. Its high specificity and sensitivity make it a valuable tool for researchers studying muscle-related disorders or exploring potential therapeutic targets.</p>

<p>Rabbit polyclonal SIPA1 antibody</p>

<p>Plasminogen antibody was raised in sheep using human plasminogen purified from plasma as the immunogen.</p>

<p>The HSP antibody is a monoclonal antibody that has pharmacokinetic properties. It is formulated using crystalline cellulose and human serum, making it highly effective in targeting specific biomolecules. This antibody has been shown to be particularly effective in treating choroidal neovascularization, a condition characterized by abnormal blood vessel growth in the eye. The HSP antibody works by neutralizing oxidative damage and preventing toxic effects on the retina. Additionally, this monoclonal antibody has shown promising results in combination with sorafenib, an inhibitor of epidermal growth factor receptors. With its potent therapeutic properties, the HSP antibody is a valuable tool in the field of life sciences and holds great potential for future medical advancements.</p>

<p>Mouse monoclonal Hepatitis C Virus NS3 antibody</p>

<p>The STAT5A antibody is a highly specialized antibody used in the field of Life Sciences. It is designed to specifically target and bind to STAT5A, a protein involved in various cellular processes. This monoclonal antibody has been extensively tested and proven to have high specificity and sensitivity.</p>

<p>DHX32 antibody was raised in Rabbit using Human DHX32 as the immunogen</p>

<p>Rabbit Polyclonal GIMAP2 antibody</p>

<p>Rabbit Polyclonal STAT5A antibody (Ser725)</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections and contains active compounds known for their bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, inhibiting bacterial growth and preventing transcription and replication. Its effectiveness has been demonstrated through extensive testing using the patch-clamp technique on human erythrocytes. The active form of this drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains, inhibiting their cell growth in culture.</p>

<p>The bRAF antibody is a highly reactive and immobilizing antibody that is used in Life Sciences research. It is capable of neutralizing the binding proteins associated with bRAF, an important protein involved in cell signaling pathways. This antibody can be used for various applications, including Western blotting, immunoprecipitation, and immunofluorescence. The bRAF antibody has been shown to be effective in detecting the presence of bRAF in human serum samples and mesenchymal stem cells. It is available as both polyclonal and monoclonal antibodies, allowing researchers to choose the best option for their specific needs. With its high specificity and affinity, the bRAF antibody provides accurate and reliable results for a wide range of experiments.</p>

<p>Rabbit Polyclonal OR4K14 antibody</p>

<p>This HRP Conjugated Goat anti-Dog IgE specifically reacts with the IgE heavy chain and not with IgG, IgA, IgM or IgD. It is suitable for use as the detection antibody in various immunoassays.</p>

<p>CST1 antibody was raised in Rabbit using Human CST1 as the immunogen</p>

<p>NOB1 antibody was raised using a synthetic peptide corresponding to a region with amino acids TEIRDKATRRRLAVLPYELRFKEPLPEYVRLVTEFSKKTGDYPSLSATDI</p>

<p>Purified Rabbit polyclonal CKLF3 antibody</p>

<p>Rabbit polyclonal ZAP70 antibody (Tyr292)</p>

<p>The IFNGR antibody is a highly specific polyclonal antibody that targets the interferon gamma receptor (IFNGR). It is widely used in life sciences research to study the role of IFNGR in various cellular processes. This antibody exhibits high affinity and specificity for IFNGR, making it an excellent tool for detecting and quantifying IFNGR expression levels in different cell types.</p>

<p>Rabbit polyclonal EGFR antibody (Ser1070)</p>

<p>The Tetracycline antibody is a highly specific monoclonal antibody that binds to tetracycline, a broad-spectrum antibiotic. This antibody has a high receptor binding affinity and can be used in various applications, such as polymerase chain reactions (PCR), immunohistochemistry, and Western blotting. It specifically targets tetracycline residues in biological samples, allowing for the detection and quantification of this antibiotic. In addition to its use in research, the Tetracycline antibody has potential applications in the field of medicine. It can be used to study the cellular localization of tetracycline within cells or tissues, providing valuable insights into its mechanism of action. Furthermore, this antibody can be utilized to investigate protein-protein interactions involving tetracycline or its derivatives. The Tetracycline antibody is produced using advanced techniques in monoclonal antibody production. It exhibits high specificity and sensitivity, ensuring reliable and accurate results. This antibody is compatible with various sample types, including</p>