Anticorps primaires

<p>DCDC2 antibody was raised using the middle region of DCDC2 corresponding to a region with amino acids KGSGNDRHSKSTVGSSDNSSPQPLKRKGKKEDVNSEKLTKLKQNVKLKNS</p>

<p>The ENDOG antibody is a highly potent cytotoxic monoclonal antibody used in the field of Life Sciences. This antibody specifically targets and binds to annexin, an important protein involved in endothelial growth. By binding to annexin, the ENDOG antibody inhibits the growth and proliferation of endothelial cells, making it a valuable tool for studying angiogenesis and tumor development. Additionally, this antibody has shown promising results in interfering with various cellular processes, including interferon signaling and lipoprotein lipase activity. With its high specificity and affinity for its target, the ENDOG antibody is a valuable tool for researchers in the field of Life Sciences.</p>

<p>TMEM127 antibody was raised using the middle region of TMEM127 corresponding to a region with amino acids AFLLDVFGPKHPALKITRRYAFAHILTVLQCATVIGFSYWASELILAQQQ</p>

<p>Purified Rabbit polyclonal OR51F2 antibody</p>

<p>The NMDAR2B antibody is a polyclonal antibody that targets the N-methyl-D-aspartate receptor subunit 2B (NMDAR2B). This antibody specifically binds to annexin A2, insulin, alpha-fetoprotein, and pancreatic glucagon. It can be used in various life science research applications, including immunohistochemistry, Western blotting, and enzyme-linked immunosorbent assay (ELISA). The NMDAR2B antibody is available as both polyclonal and monoclonal antibodies and is suitable for use in human serum samples. With its high specificity and sensitivity, this antibody is a valuable tool for studying the role of NMDAR2B in various biological processes.</p>

<p>CLACP antibody was raised in rabbit using residues 430-443 [DYNGNLHEALQRIT] of the NC3 region of human and mouse CLAC-P as the immunogen.</p>

<p>The STAT5B antibody is a highly specialized product used in the field of Life Sciences. It is designed to specifically target and inhibit the activity of STAT5B, a nuclear protein involved in various cellular processes. This antibody has been extensively tested and validated for its effectiveness in blocking the function of STAT5B.</p>

<p>BDH2 antibody was raised using the middle region of BDH2 corresponding to a region with amino acids NRCVYSTTKAAVIGLTKSVAADFIQQGIRCNCVCPGTVDTPSLQERIQAR</p>

<p>This HRP Conjugated Goat anti-Dog IgE specifically reacts with the IgE heavy chain and not with IgG, IgA, IgM or IgD. It is suitable for use as the detection antibody in various immunoassays.</p>

<p>The HPT antibody is a glycoprotein that belongs to the class of Monoclonal Antibodies. It exhibits cytotoxic properties and has been extensively studied in the field of Life Sciences. The HPT antibody specifically targets glutamate receptors and serine proteases, inhibiting their activity and preventing cell damage. In addition, it forms dimers that can be easily detected using colloidal gold labeling techniques. The HPT antibody has been shown to enhance the production of interferon-gamma (IFN-gamma), an important cytokine involved in immune responses. This antibody can also be used as an anti-prlr antibody, targeting the prolactin receptor and blocking its signaling pathway. Furthermore, the HPT antibody has been found to scavenge superoxide radicals, reducing oxidative stress in cells. Overall, this versatile antibody offers a wide range of applications in research and diagnostics within the field of Life Sciences.</p>

<p>Rabbit polyclonal GJB7 antibody</p>

<p>Rabbit polyclonal AN32C antibody</p>

<p>HEF1/NEDD-9 Monoclonal Antibody</p>

<p>SLC45A2 antibody was raised using the C terminal of SLC45A2 corresponding to a region with amino acids IGWTAFLSNMLFFTDFMGQIVYRGDPYSAHNSTEFLIYERGVEVGCWGFC</p>

<p>NEK6 antibody was raised using a synthetic peptide corresponding to a region with amino acids FRCSLADFQIEKKIGRGQFSEVYKATCLLDRKTVALKKVQIFEMMDAKAR</p>

<p>Rabbit polyclonal CD44 antibody (Ser706)</p>

<p>PTPRE antibody was raised using the middle region of PTPRE corresponding to a region with amino acids VILSMKRGQEYTDYINASFIDGYRQKDYFIATQGPLAHTVEDFWRMIWEW</p>

<p>Rabbit polyclonal DNAPK antibody</p>

<p>INSL5 antibody was raised using the middle region of INSL5 corresponding to a region with amino acids RTVIYICASSRWRRHQEGIPQAQQAETGNSFQLPHKREFSEENPAQNLPK</p>

<p>SNRPA antibody was raised in rabbit using the N terminal of SNRPA as the immunogen</p>

<p>The MERTK antibody is a highly specialized monoclonal antibody used in Life Sciences research. It specifically targets the MERTK protein, which plays a crucial role in various cellular processes. This antibody is widely used in studies related to collagen, blood plasma, interferon, and platelet-derived growth factor-bb.</p>

<p>Rabbit polyclonal RBM9 antibody</p>

<p>Apbb1 antibody was raised in rabbit using the N terminal of Apbb1 as the immunogen</p>

<p>Myeloperoxidase antibody was raised in mouse using human myeloperoxidase as the immunogen.</p>

<p>Rabbit anti-sheep IgG (HRP) was raised in rabbit using sheep IgG F(ab')2 fragment as the immunogen.</p>

<p>The Tetracycline antibody is a highly specific monoclonal antibody that binds to tetracycline, a broad-spectrum antibiotic. This antibody has a high receptor binding affinity and can be used in various applications, such as polymerase chain reactions (PCR), immunohistochemistry, and Western blotting. It specifically targets tetracycline residues in biological samples, allowing for the detection and quantification of this antibiotic. In addition to its use in research, the Tetracycline antibody has potential applications in the field of medicine. It can be used to study the cellular localization of tetracycline within cells or tissues, providing valuable insights into its mechanism of action. Furthermore, this antibody can be utilized to investigate protein-protein interactions involving tetracycline or its derivatives. The Tetracycline antibody is produced using advanced techniques in monoclonal antibody production. It exhibits high specificity and sensitivity, ensuring reliable and accurate results. This antibody is compatible with various sample types, including</p>