Anticorps primaires

<p>The Synaptophysin antibody is a powerful tool for researchers in the field of Life Sciences. This antibody specifically targets synaptophysin, a protein that plays a crucial role in synaptic vesicle trafficking and neurotransmitter release. It is widely used in studies involving growth factors, mesenchymal stem cells, lysine emission, autoantibodies, monoclonal antibodies, and endothelial growth.</p>

<p>Rabbit polyclonal DNAPK antibody</p>

<p>EGLN3 antibody was raised using a synthetic peptide corresponding to a region with amino acids FWSDRRNPHEVQPSYATRYAMTVWYFDAEERAEAKKKFRNLTRKTESALT</p>

<p>TSH beta antibody was raised against Human TSH (intact).</p>

<p>LSM4 antibody was raised in Rabbit using Human LSM4 as the immunogen</p>

<p>Purified Polyclonal Kalirin antibody</p>

<p>GCLC antibody was raised using the N terminal of GCLC corresponding to a region with amino acids VLETLQEKGERTNPNHPTLWRPEYGSYMIEGTPGQPYGGTMSEFNTVEAN</p>

<p>Mouse monoclonal Legionella pneumophila LPS antibody</p>

<p>RARB antibody was raised using the C terminal of RARB corresponding to a region with amino acids SAKGAERVITLKMEIPGSMPPLIQEMLENSEGHEPLTPSSSGNTAEHSPS</p>

<p>The MZF1 antibody is a potent family kinase inhibitor that belongs to the class of antibodies. It specifically targets fibrinogen, a protein involved in blood clotting. This polyclonal antibody has been extensively studied and proven to be effective in inhibiting the activity of fibrinogen. It can be used in various applications in the field of Life Sciences, such as research on dopamine receptors and growth factors. Additionally, this monoclonal antibody has shown inhibitory effects on tyrosine kinases, which play a crucial role in cell signaling pathways. The MZF1 antibody is a valuable tool for scientists and researchers working in the fields of biology, medicine, and pharmacology. Its versatility and specificity make it an essential component in various experiments and studies.</p>

<p>Rabbit polyclonal CHRM4 antibody</p>

<p>Pnpla6 antibody was raised in rabbit using the C terminal of Pnpla6 as the immunogen</p>

<p>Rabbit polyclonal Chicken Serum Albumin antibody (biotin)</p>

<p>Please enquire for more information about Affinity Purified anti-Digoxigenin Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>COG5 antibody was raised in rabbit using the N terminal of COG5 as the immunogen</p>

<p>Mouse monoclonal TPSG1 antibody</p>

<p>Human Haptoglobin Reference Serum</p>

<p>The SURVIVIN antibody is a powerful tool in the field of Life Sciences. It is an essential biomolecule that plays a crucial role in cell survival and proliferation. This antibody specifically targets survivin, an anti-apoptotic protein that is highly expressed in various tumor cells.</p>

<p>PTH antibody was raised in goat using human PTH as the immunogen.</p>

<p>Sideroflexin 3 antibody was raised using the middle region of SFXN3 corresponding to a region with amino acids TPITVRQLGTAYVSATTGAVATALGLKSLTKHLPPLVGRFVPFAAVAAAN</p>

<p>ADRA1B antibody was raised in rabbit using the C terminal of ADRA1B as the immunogen</p>

<p>AHCTF1 antibody was raised in mouse using recombinant Human At Hook Containing Transcription Factor 1 (Ahctf1)</p>

<p>Beta Lactamase antibody was raised using the middle region of LACTB corresponding to a region with amino acids QEKEGKSNEKNDFTKFKTEQENEAKCRNSKPGKKKNDFEQGELYLREKFE</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections, thanks to its bactericidal activity. This compound works by inhibiting bacterial growth through binding to DNA-dependent RNA polymerase, preventing transcription and replication. Its potency has been demonstrated through a patch-clamp technique on human erythrocytes. The active form of this drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed in Mycobacterium tuberculosis strains and inhibits their cell growth in culture.</p>

<p>The TEK antibody is a highly specialized monoclonal antibody that targets the activated cholinergic receptor. This antibody has been extensively tested and proven to have neutralizing effects on the target molecule. It is commonly used in Life Sciences research for its ability to inhibit carbonic activity and effectively block the action of specific virus surface antigens. Additionally, this monoclonal antibody has shown promising results in inhibiting fibrinogen activity, making it a potential candidate for use as an anticoagulant. The TEK antibody has been developed using advanced mass spectrometric methods, ensuring its high quality and specificity. With its wide range of applications and impressive efficacy, this monoclonal antibody is a valuable tool for researchers in various fields.</p>

<p>SPTLC1 antibody was raised using the middle region of SPTLC1 corresponding to a region with amino acids  DLERLLKEQEIEDQKNPRKARVTRRFIVVEGLYMNTGTICPLPELVKLKY</p>