Anticorps primaires
Sous-catégories appartenant à la catégorie "Anticorps primaires"
- Anticorps pour la recherche sur le cancer(3.620 produits)
- Anticorps cardio-vasculaires(2 produits)
- Biologie du développement(751 produits)
- Anticorps relatifs à l’épigénétique(162 produits)
- Anticorps d'immunologie(2.621 produits)
- Anticorps du métabolisme(279 produits)
- Anticorps de microbiologie(739 produits)
- Transduction du signal(2.717 produits)
- Tags & Marqueurs cellulaires(33 produits)
75447 produits trouvés pour "Anticorps primaires"
WFDC1 antibody
WFDC1 antibody was raised using the middle region of WFDC1 corresponding to a region with amino acids VAEGIPNRGQCVKQRRQADGRILRHKLYKEYPEGDSKNVAEPGRGQQKHF
CEND1 antibody
CEND1 antibody was raised using the N terminal of CEND1 corresponding to a region with amino acids MESRGKSASSPKPDTKVPQVTTEAKVPPAADGKAPLTKPSKKEAPAEKQQ
Degré de pureté :Min. 95%NNMT antibody
NNMT antibody was raised using the N terminal of NNMT corresponding to a region with amino acids MESGFTSKDTYLSHFNPRDYLEKYYKFGSRHSAESQILKHLLKNLFKIFC
Zfp472 antibody
Zfp472 antibody was raised in rabbit using the N terminal of Zfp472 as the immunogen
Degré de pureté :Min. 95%Human Growth Hormone antibody (HRP)
Human Growth Hormone antibody was raised in Rat using recombinant human growth hormone as the immunogen.
EWSR1 antibody
EWSR1 antibody was raised using the N terminal of EWSR1 corresponding to a region with amino acids PQVPGSYPMQPVTAPPSYPPTSYSSTQPTSYDQSSYSQQNTYGQPSSYGQ
STK17A antibody
STK17A antibody was raised in mouse using recombinant Human Serine/Threonine Kinase 17A (Apoptosis-Inducing)
GADD45A antibody
GADD45A antibody was raised in rabbit using the C terminal of GADD45A as the immunogen
Bin1 antibody
Bin1 antibody was raised in rabbit using the N terminal of Bin1 as the immunogen
Degré de pureté :Min. 95%Donkey anti Rat IgG (H + L) (Fab'2) (PE)
Donkey anti-rat IgG (H + L) (Fab'2) (PE) was raised in donkey using Rat IgG (H&L) as the immunogen.
Degré de pureté :Min. 95%HSD11B1 antibody
HSD11B1 antibody was raised using a synthetic peptide corresponding to a region with amino acids QKVVSHCLELGAASAHYIAGTMEDMTFAEQFVAQAGKLMGGLDMLILNHI
Degré de pureté :Min. 95%SHMT2 antibody
The SHMT2 antibody is a highly specialized monoclonal antibody that targets the serine hydroxymethyltransferase 2 (SHMT2) protein. This protein plays a crucial role in the metabolism of fatty acids and acts as a growth factor in various cellular processes. The SHMT2 antibody specifically binds to the SHMT2 protein, allowing for its detection and analysis in research and diagnostic applications.
LIPT1 antibody
LIPT1 antibody was raised using the N terminal of LIPT1 corresponding to a region with amino acids NCFQLLCNCQVPAAGFKKTVKNGLILQSISNDVYQNLAVEDWIHDHMNLE
Prefoldin 5 antibody
The Prefoldin 5 antibody is a powerful tool for researchers in the field of Life Sciences. This antibody specifically targets transthyretin, an important protein involved in various biological processes. The antibody-drug complex can be immobilized on an electrode surface and activated under acidic conditions. This enables researchers to study the interaction between transthyretin and other molecules such as chemokines, interferons, and monoclonal antibodies. The Prefoldin 5 antibody is widely used in techniques like immunohistochemistry to visualize the distribution of transthyretin in tissues. With its high specificity and sensitivity, this antibody is an invaluable asset for any researcher working in the field of Life Sciences.
Arntl2 antibody
Arntl2 antibody was raised in rabbit using the C terminal of Arntl2 as the immunogen
Degré de pureté :Min. 95%KCNQ2 antibody
KCNQ2 antibody was raised using the middle region of KCNQ2 corresponding to a region with amino acids GNVFATSALRSLRFLQILRMIRMDRRGGTWKLLGSVVYAHSKELVTAWYI
WDR5 antibody
WDR5 antibody was raised in rabbit using the C terminal of WDR5 as the immunogen
Degré de pureté :Min. 95%EEF2 antibody
The EEF2 antibody is a highly specific monoclonal antibody that is widely used in life sciences research. It binds to and detects the eukaryotic elongation factor 2 (EEF2) protein, which plays a crucial role in protein synthesis. This antibody has been extensively validated for various applications, including immunohistochemistry, western blotting, and flow cytometry.
Smpdl3a antibody
Smpdl3a antibody was raised in rabbit using the N terminal of Smpdl3a as the immunogen
Degré de pureté :Min. 95%RGS13 antibody
RGS13 antibody was raised using the middle region of RGS13 corresponding to a region with amino acids WSRISRAKKLYKIYIQPQSPREINIDSSTRETIIRNIQEPTETCFEEAQK
PYK2 antibody
The PYK2 antibody is a highly specific monoclonal antibody that targets PYK2, a tyrosine kinase protein involved in various cellular processes. This antibody has been extensively tested and validated for its ability to neutralize the activity of PYK2, making it an invaluable tool for researchers studying signal transduction pathways and cell signaling mechanisms. The PYK2 antibody can be used in a variety of applications, including Western blotting, immunoprecipitation, immunofluorescence, and flow cytometry. It is available as both a purified monoclonal antibody and as part of a kit that includes all the necessary reagents for successful experiments. With its high specificity and sensitivity, the PYK2 antibody is an essential tool for any researcher working with PYK2-related studies.
RAB40A antibody
RAB40A antibody was raised using the middle region of RAB40A corresponding to a region with amino acids RPSKVLSLQDLCCRTIVSCTPVHLVDKLPLPSTLRSHLKSFSMAKGLNAR
Degré de pureté :Min. 95%
