Anticorps primaires
Sous-catégories appartenant à la catégorie "Anticorps primaires"
- Anticorps pour la recherche sur le cancer(3.620 produits)
- Anticorps cardio-vasculaires(2 produits)
- Biologie du développement(751 produits)
- Anticorps relatifs à l’épigénétique(162 produits)
- Anticorps d'immunologie(2.551 produits)
- Anticorps du métabolisme(279 produits)
- Anticorps de microbiologie(740 produits)
- Transduction du signal(2.717 produits)
- Tags & Marqueurs cellulaires(33 produits)
75448 produits trouvés pour "Anticorps primaires"
LGALS3BP antibody
The LGALS3BP antibody is a monoclonal antibody that has been developed for use in various applications within the field of Life Sciences. It specifically targets LGALS3BP, a protein involved in multiple cellular processes including cell signaling, immune response, and cancer progression.
Influenza A antibody
Influenza A antibody was raised in mouse using Influenza A nucleoprotein as the immunogen.p53 antibody
The p53 antibody is a highly effective inhibitor used in Life Sciences research. This monoclonal antibody specifically targets and neutralizes the p53 protein, which plays a crucial role in regulating cell growth and preventing tumor formation. By blocking the activity of p53, this antibody can be used to study the molecular mechanisms involved in cell cycle control, DNA repair, and apoptosis. Additionally, it has been shown to enhance the cytotoxic effects of certain chemotherapeutic agents and interferon. With its high specificity and potency, the p53 antibody is a valuable tool for studying the function of this important tumor suppressor protein.
Enterobacteriaciae Antibody
Mouse anti-Enterobacteriaciae AntibodyDegré de pureté :> 90% By Immunoelectrophoresis Using AgaroseRORA antibody
RORA antibody was raised using the N terminal of RORA corresponding to a region with amino acids TPTPAGEGARRDELFGILQILHQCILSSGDAFVLTGVCCSWRQNGKPPYS
CLIC4 antibody
CLIC4 antibody was raised using the N terminal of CLIC4 corresponding to a region with amino acids LSMPLNGLKEEDKEPLIELFVKAGSDGESIGNCPFSQRLFMILWLKGVVF
PSPH antibody
The PSPH antibody is a monoclonal antibody produced by a hybridoma cell strain. It is designed to specifically target and bind to the PSPH protein, which plays a crucial role in various biological processes. The antibody can be used in life sciences research, diagnostic assays, and therapeutic applications.
CD66b antibody
The CD66b antibody is a monoclonal antibody that has a stimulatory effect on epidermal growth factor (EGF) signaling. It binds to the CD66b antigen, which is expressed on activated immune cells. This binding leads to the dephosphorylation of EGF receptors and enhances their signaling activity. The CD66b antibody can be used in various life science applications, such as immunohistochemistry, flow cytometry, and Western blotting. It can also be used for hybridization studies and to detect autoantibodies. Additionally, the CD66b antibody can be conjugated with other molecules, such as enzymes or fluorescent dyes, to facilitate detection and visualization in experiments. Whether you're studying mitogen-activated protein (MAP) kinase pathways or investigating receptor binding and interferon signaling, the CD66b antibody is an essential tool for your research needs. Choose from a range of formats, including chimeric proteins and polyclonal antibodies, to
WBSCR1 antibody
WBSCR1 antibody was raised using the middle region of Wbscr1 corresponding to a region with amino acids DSRDDFNSGFRDDFLGGRGGSRPGDRRTGPPMGSRFRDGPPLRGSNMDFR
FZD4 antibody
The FZD4 antibody is a highly specialized antibody that targets the FZD4 protein. This protein plays a crucial role in various cellular processes, including actin dynamics and signaling pathways involved in development and disease. The FZD4 antibody is available in both polyclonal and monoclonal forms, offering researchers the flexibility to choose the best option for their specific experiments.
TFPI antibody
TFPI antibody is a monoclonal antibody that targets tissue factor pathway inhibitor (TFPI), a protein involved in the regulation of blood clotting. TFPI antibody inhibits the activity of TFPI, which leads to increased blood clotting and reduced bleeding. This antibody has been shown to have anti-VEGF (vascular endothelial growth factor) properties, which may be beneficial in the treatment of diseases involving abnormal blood vessel growth, such as cancer and age-related macular degeneration. Additionally, TFPI antibody has been found to modulate hormone levels, including adipose and epidermal growth factors, which play important roles in various physiological processes. The use of TFPI antibody in Life Sciences research has also demonstrated its potential as a tool for studying the mechanisms of blood clotting and angiogenesis.
Serotonin Transporter antibody
Serotonin transporter antibody was raised in mouse using at serotonin transporter, N-terminus/GST Fusion protein (amino acids 1-85) as the immunogen.
SYN1 antibody
The SYN1 antibody is a highly specialized immunoassay tool used in Life Sciences research. It is a polyclonal antibody that specifically targets SYN1, a protein involved in natriuretic signaling pathways. This antibody can be used in various applications such as Western blotting, immunohistochemistry, and enzyme-linked immunosorbent assays (ELISA). The SYN1 antibody is designed to detect the presence of SYN1 in pharmaceutical preparations and biological samples. It can be used to study the role of SYN1 in different cellular processes, including dopamine release, hypoxia-inducible factor-1 activation, and cytochrome P450 oxidoreductase activity. Researchers can use this antibody to investigate the effects of rapamycin treatment on SYN1 expression and function. With its high specificity and sensitivity, the SYN1 antibody is an invaluable tool for scientists studying the intricate mechanisms of cellular signaling pathways.
GJC3 antibody
GJC3 antibody was raised in rabbit using the middle region of GJC3 as the immunogen
Degré de pureté :Min. 95%Complement C3b beta antibody
Complement C3b beta antibody was raised in mouse using human complement component C3 as the immunogen.
Rabbit anti Guinea Pig IgG (H + L) (rhodamine)
Rabbit anti-guinea pig IgG (H+L) (Rhodamine) was raised in rabbit using guinea pig IgG whole molecule as the immunogen.
Degré de pureté :Min. 95%HBsAg Mouse Monoclonal Antibody
Please enquire for more information about HBsAg Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page
Degré de pureté :Min. 95%Dengue Virus Type 1 Envelope Antigen, Recombinant
Please enquire for more information about Dengue Virus Type 1 Envelope Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page
Degré de pureté :Min. 95%Denosumab
CAS :Monoclonal antibody against RANKL; anti-resorptive agent for osteoperosis treatment
Degré de pureté :(Sec-Hplc) Min. 95 Area-%Couleur et forme :Clear LiquidCA 125 antibody (biotin)
CA 125 antibody (biotin) was raised in mouse using affinity pure human CA 125 antigen as the immunogen.
