Anticorps primaires

The Fibronectin antibody is an antigen binding molecule that specifically targets fibronectin, a protein involved in cell adhesion and migration. It has been shown to inhibit the activation of tyrosine kinase receptors and block the binding of fibronectin to its receptors on cells. This antibody can be used in various applications such as immunohistochemistry, western blotting, and flow cytometry to study the biological effects of fibronectin in different tissues and cell types.

Lipase J antibody was raised using the C terminal of LIPJ corresponding to a region with amino acids LNLVHYNQTTSPLYNMTNMNVATAIWNGKSDLLADPEDVNILHSEITNHI

Rabbit polyclonal TF3B antibody

The KLK1 antibody is a polyclonal antibody that is used in life sciences research. It is designed to target and neutralize the effects of acetylcholine, interferon, chemokine, and other molecules involved in intraocular endothelial growth. This antibody has been shown to be effective in blocking the activity of these molecules, thereby inhibiting their effects on cell growth and function. Additionally, the KLK1 antibody can be used to detect the presence of autoantibodies or test compounds in biological samples. Its high specificity and affinity make it an essential tool for researchers studying growth factors and their role in various physiological processes.

The STAT1 antibody is a highly specialized monoclonal antibody that targets the signal transducer and activator of transcription 1 (STAT1) protein. This antibody is commonly used in life sciences research to study various cellular processes, including growth factor signaling, insulin regulation, and immune responses.

The SMUG1 antibody is a highly specific and potent antibody that can be used in various applications in the field of Life Sciences. It is available as both polyclonal and monoclonal antibodies, providing researchers with flexibility in their experimental design.

DNAJB8 antibody was raised in Rabbit using Human DNAJB8 as the immunogen

The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug belonging to the class of rifamycins. It is specifically designed to combat tuberculosis infections by targeting the active compounds responsible for bacterial growth. This bactericidal activity is achieved by inhibiting DNA-dependent RNA polymerase, which hinders transcription and replication processes essential for bacterial survival. The effectiveness of this drug has been confirmed through extensive testing using advanced techniques such as patch-clamp on human erythrocytes. Additionally, its metabolic transformations include hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Moreover, it exhibits high affinity towards markers expressed in Mycobacterium tuberculosis strains and effectively impedes their growth in culture.

Mouse monoclonal SDR9C7 antibody

The Ibuprofen antibody is a highly specialized monoclonal antibody that targets and inhibits the activity of Ibuprofen, a nonsteroidal anti-inflammatory drug (NSAID). It has been extensively studied in the field of Life Sciences for its potential therapeutic applications. The antibody specifically binds to Ibuprofen, leading to its neutralization and preventing it from exerting its anti-inflammatory effects.

Affinity purified Rabbit polyclonal CDC37L1 antibody

The Homer antibody is a growth factor that is commonly found in human serum. It is widely used in Life Sciences research and has been shown to have neutralizing effects on various nuclear factors. The antibody can be used for both in vitro and in vivo experiments, making it a versatile tool for researchers. It is available as both monoclonal and polyclonal antibodies, allowing for flexibility in experimental design. The Homer antibody has been extensively studied for its role in inhibiting the activity of mesothelin, a protein involved in cancer progression. Additionally, it has shown potential as an inhibitor of fibrinogen, collagen, and alpha-fetoprotein. Its antiviral properties make it a valuable asset in the field of virology research. With its wide range of applications and proven efficacy, the Homer antibody is a must-have for any researcher looking to advance their scientific understanding.

The HTR1A antibody is a highly valuable product in the field of Life Sciences. It plays a crucial role as a heparin cofactor and is used in various medical applications, including as an inhibitor for certain medications. Additionally, this antibody has been found to have significant effects on fetal hemoglobin and autoantibodies.

Affinity purified Rabbit polyclonal EXOC7 antibody

The MST4 antibody is a polyclonal antibody that specifically targets and binds to the triglyceride lipase known as MST4. This antibody is widely used in life sciences research to study the role of MST4 in various biological processes. It has been shown to be effective in detecting and quantifying MST4 levels in adipose tissue, as well as its involvement in signaling pathways regulated by TGF-β1. The MST4 antibody can also be used for immunohistochemistry, Western blotting, and other techniques to analyze the expression and localization of MST4 in different cell types and tissues. With its high specificity and sensitivity, this antibody is an invaluable tool for researchers studying lipase function and related diseases such as obesity and metabolic disorders.

CCPG1 antibody was raised in Rabbit using Human CCPG1 as the immunogen

Affinity purified Rabbit polyclonal SUCLG1 antibody

IL33 antibody was raised in Rabbit using Human IL33 as the immunogen

ALKBH4 antibody was raised in Rabbit using Human ALKBH4 as the immunogen

HADH antibody was raised in Rabbit using Human HADH as the immunogen

Affinity purified Rabbit polyclonal PDSS2 antibody

CPNE6 antibody was raised in Rabbit using Human CPNE6 as the immunogen

Rabbit polyclonal EPHB2 antibody (Tyr298)

ARPC2 antibody was raised in Rabbit using Human ARPC2 as the immunogen

The LIF antibody is a polyclonal antibody used in the field of Life Sciences. It specifically targets and inhibits the activity of leukemia inhibitory factor (LIF), which is an important growth factor involved in various cellular processes. This antibody can be used to study the role of LIF in different biological systems, including liver microsomes and hybridoma cells. By blocking the action of LIF, this antibody can potentially have cytotoxic effects on specific cell types, such as cholinergic and catecholaminergic neurons. Additionally, it may be useful for investigating the effects of LIF inhibitors on dopamine signaling pathways. With its high specificity and potency, the LIF antibody is a valuable tool for researchers studying the function and regulation of LIF in various physiological and pathological conditions.

The CEA Antibody is a growth factor that belongs to the family of antibodies. It specifically targets anti-ACTH antibodies and acts as a monoclonal antibody. This antibody has been shown to inhibit the activity of kinase inhibitors, which are involved in various biological processes. Additionally, it interacts with adipose tissue and fibrinogen, playing a crucial role in Life Sciences research. The CEA Antibody also modulates dopamine levels and exhibits binding affinity towards low-density lipoprotein receptors and annexin proteins. Furthermore, it interacts with adiponectin receptors, contributing to the regulation of adiponectin levels in the body. With its multifaceted properties, the CEA Antibody offers great potential for scientific studies and therapeutic applications.

The IL8 antibody is a highly specific antibody used in Life Sciences research. It is available as both polyclonal and monoclonal antibodies. This antibody targets IL8, which is an important chemokine involved in inflammation and immune responses. The IL8 antibody can be used for various applications, including immunohistochemistry, flow cytometry, and ELISA. It has been extensively validated and shows high sensitivity and specificity in detecting IL8 in various samples. The IL8 antibody is produced using advanced techniques to ensure high purity and activity. It is supplied as a buffered solution for easy handling and storage. Whether you are studying autoimmune diseases or investigating the role of IL8 in cancer development, the IL8 antibody is a valuable tool for your research needs.

APBA1 antibody was raised in rabbit using the N terminal of APBA1 as the immunogen

CST9L antibody was raised in Rabbit using Human CST9L as the immunogen

Affinity purified Rabbit polyclonal NCKAP1 antibody

The PGD antibody is a monoclonal antibody used in Life Sciences research. It specifically targets and binds to alpha-fetoprotein, a protein that is associated with various diseases and conditions. The PGD antibody has been extensively tested and proven to be highly specific and sensitive in detecting alpha-fetoprotein in human serum samples. It can be used for various applications such as ELISA, Western blotting, immunohistochemistry, and flow cytometry. The PGD antibody can also be conjugated with different markers or enzymes for enhanced detection and visualization. With its high affinity and cytotoxic properties, the PGD antibody holds great potential for targeted therapy in the future.

EBAG9 antibody was raised in Rabbit using Human EBAG9 as the immunogen

The SOCS3 antibody is a biomaterial protein that plays a crucial role in various biological processes. It acts as a negative regulator of cytokine signaling pathways and is involved in the regulation of growth factors. The antibody can bind to sclerostin, an important factor in bone metabolism, and inhibit its activity. Additionally, it has been shown to neutralize the effects of alpha-fetoprotein, a protein associated with liver cancer. The SOCS3 antibody is available in both polyclonal and monoclonal forms, providing researchers with options for their specific experimental needs. Its high affinity and specificity make it an invaluable tool in life sciences research.