Anticorps primaires

The HA antibody is a high-quality polyclonal antibody that is widely used in life sciences research. It is specifically designed to target and neutralize the catalase enzyme, which plays a crucial role in various biological processes. This antibody exhibits strong catalase activity and has been shown to effectively inhibit the reactive properties of catalase. Additionally, it can bind to streptavidin and other peptide agents, making it versatile for use in different experimental setups. The HA antibody is water-soluble and can be easily incorporated into various assays and experiments. It is commonly used to detect and measure antiphospholipid antibodies in human serum samples, making it an essential tool for autoimmune disease research. With its high specificity and affinity, this monoclonal antibody ensures reliable results in any scientific investigation requiring the detection or neutralization of catalase or other related enzymes.

Rabbit polyclonal PTPN18 antibody

The BHMT antibody is a monoclonal antibody that targets the cation channel inhibitors. It is used to detect autoantibodies against octanoyltransferase, which is an enzyme involved in the metabolism of carnitine. BHMT antibody can be used as part of diagnostic tests to identify individuals with deficiencies in this enzyme or those who may benefit from targeted therapies. This antibody is also commonly used in research settings to study the role of cation channels and methyl transferases in various diseases and conditions. With its high specificity and sensitivity, the BHMT antibody is a valuable tool for scientists and healthcare professionals alike.

GPR20 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.

Rabbit polyclonal CD19 antibody (Tyr531)

Fibrinogen antibody was raised in sheep using human Fibrinogen purified from plasma as the immunogen.

WFDC1 antibody was raised using the middle region of WFDC1 corresponding to a region with amino acids VAEGIPNRGQCVKQRRQADGRILRHKLYKEYPEGDSKNVAEPGRGQQKHF

The MBP antibody is a highly specialized antibody that targets and neutralizes myelin basic protein (MBP). MBP is a key component of the myelin sheath, which surrounds and protects nerve fibers in the central nervous system. By targeting MBP, this antibody can disrupt the normal functioning of myelin and has potential applications in autoimmune disorders such as multiple sclerosis.

CDC73 antibody was raised in Rabbit using Human CDC73 as the immunogen

Affinity purified Rabbit polyclonal Cyclin T2 antibody

The iNOS antibody is a neuroprotective monoclonal antibody that targets inducible nitric oxide synthase (iNOS). It is commonly used in Life Sciences research and has shown promising results in various studies. This antibody specifically binds to iNOS, inhibiting its activity and preventing the production of nitric oxide. Nitric oxide is a signaling molecule that plays a role in various physiological processes, including inflammation and neuronal signaling. By blocking iNOS, the antibody can help reduce inflammation and protect neurons from damage.

Rabbit anti Mouse IgM is a monoclonal antibody that belongs to the category of antibodies. It is specifically designed to target and bind to mouse IgM, making it an essential tool for various research applications in the field of Life Sciences. This antibody can be used for studying the role of IgM in different biological processes such as anti-VEGF (vascular endothelial growth factor) therapy, adiponectin signaling, β-catenin regulation, and more. Additionally, Rabbit anti Mouse IgM can be utilized for detecting specific proteins like human chorionic gonadotropin (hCG), alpha-synuclein, epidermal growth factor (EGF), c-myc, and glycopeptides. Its binding ability allows researchers to explore these proteins' functions and interactions within cellular pathways. Furthermore, this antibody has been shown to induce Fas-mediated apoptosis in certain experimental settings. With its high specificity and versatility, Rabbit anti Mouse IgM is an invaluable tool for advancing scientific

The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the category of rifamycins. It is known to effectively treat tuberculosis infections by targeting active compounds and exhibiting bactericidal activity. Through its binding to DNA-dependent RNA polymerase, this drug inhibits bacterial growth, preventing transcription and replication. Its efficacy has been demonstrated through patch-clamp technique studies on human erythrocytes. The drug undergoes various metabolic transformations, including hydrolysis, oxidation, reduction, and conjugation with glucuronic acid. Additionally, it specifically binds to markers expressed in Mycobacterium tuberculosis strains, inhibiting their growth in culture.

SLC25A29 antibody was raised using the C terminal of SLC25A29 corresponding to a region with amino acids AEGWRVFTRGLASTLLRAFPVNAATFATVTVVLTYARGEEAGPEGEAVPA

DLEU1 antibody was raised in Rabbit using Human DLEU1 as the immunogen

Mouse anti-25OH Vitamin D2/D3 antibody

Rabbit polyclonal RAB31 antibody

Rabbit polyclonal TIA1 antibody

VSV-G antibody was raised in rabbit using VSV-G (YTDIEMNRLGK) conjugated to KLH as the immunogen.

Rabbit polyclonal TXNL6 antibody

Rabbit polyclonal PP2A antibody (FITC)

The ZHX2 antibody is a powerful tool used in the field of Life Sciences. It specifically targets and binds to collagen, a protein found abundantly in the body. This antibody has shown antinociceptive properties, meaning it can help alleviate pain sensations. Additionally, it has been observed to be effective in inhibiting the activation of certain phosphorylation sites, which play a crucial role in cellular signaling pathways.

Rabbit polyclonal SIK antibody

PTGES antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.

LIPT1 antibody was raised using the N terminal of LIPT1 corresponding to a region with amino acids NCFQLLCNCQVPAAGFKKTVKNGLILQSISNDVYQNLAVEDWIHDHMNLE

The GCP2 antibody is a highly specific antibody that targets collagen and neutralizes the activity of autoantibodies. It is commonly used in Life Sciences research to study the role of TNF-α, growth factors, and chemokines in various biological processes. This polyclonal antibody has been shown to effectively bind to activated fibronectin and inhibit the activity of TGF-beta. With its high specificity and affinity, the GCP2 antibody is a valuable tool for researchers studying the molecular mechanisms underlying various diseases and physiological processes.

ANKRD42 antibody was raised using the N terminal of ANKRD42 corresponding to a region with amino acids PLHLAATHGHSFTLQIMLRSGVDPSVTDKREWRPVHYAAFHGRLGCLQLL

Mouse monoclonal Cytokeratin 4+5+6+8+10+13+18 antibody (Prediluted for IHC)

CD11a antibody (Azide Free) was raised in rat using murine CD11a (LFA-1a) as the immunogen.

Rabbit polyclonal SERPINH1 antibody

RALGPS2 antibody was raised using the C terminal of RALGPS2 corresponding to a region with amino acids YLGIYLSDLTYIDSAYPSTGSILENEQRSNLMNNILRIISDLQQSCEYDI

Rabbit polyclonal VOPP1 antibody (FITC)

Protein S antibody is a highly specialized product in the field of Life Sciences. It is used for various applications such as particle chemiluminescence and polymerase chain reactions. This antibody is specifically designed to neutralize autoantibodies against human protein S, which plays a crucial role in the coagulation process. By targeting these autoantibodies, Protein S antibody enables accurate immunoassays and antigen-antibody reactions in research and diagnostic settings.

CDK7 antibody was raised in rabbit using the C terminal of CDK7 as the immunogen

Rabbit polyclonal FRS2 antibody

Mouse monoclonal C17orf28 antibody

CD8a antibody (Spectral Red) was raised in rat using murine thymus or spleen as the immunogen.

The JAK1 antibody is a highly specific monoclonal antibody used in the field of Life Sciences. It is designed to target and bind to the Janus kinase 1 (JAK1) protein, which plays a crucial role in various cellular processes including immune response and cell growth. By inhibiting the activity of JAK1, this antibody has antiviral properties and can be used for research purposes in studying viral infections.

Please enquire for more information about HBsAg Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page

Please enquire for more information about Dengue Virus Type 1 Envelope Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page

Monoclonal antibody against RANKL; anti-resorptive agent for osteoperosis treatment

CA 125 antibody (biotin) was raised in mouse using affinity pure human CA 125 antigen as the immunogen.

Cortisol antibody was raised in mouse using cortisol-3 BSA as the immunogen.