Anticorps primaires

<p>EAPP Monoclonal Antibody</p>

<p>Rabbit Polyclonal ATP5H antibody</p>

<p>The Paxillin antibody is a powerful tool used in the field of Life Sciences. It is a monoclonal antibody that specifically targets and neutralizes paxillin, a protein involved in cell adhesion and migration. This antibody has been widely used in research to study various cellular processes, including growth factor signaling, chemokine-induced migration, lipoprotein lipase activity, TGF-beta signaling, and more. The Paxillin antibody has also shown cytotoxic effects on activated cells and has been used as a therapeutic agent in certain diseases. With its ability to specifically bind to paxillin and inhibit its function, this antibody has become an essential tool for scientists studying cell biology and related fields.</p>

<p>Rabbit polyclonal Connexin 43 antibody (Ser261)</p>

<p>The hnRNP L Antibody is a highly specific monoclonal antibody that is widely used in life sciences research. This cytotoxic antibody targets hnRNP L, a nuclear protein involved in various cellular processes such as RNA splicing, transport, and stability. The hnRNP L Antibody has been extensively validated for use in assays such as immunofluorescence, immunohistochemistry, and western blotting. It provides reliable and reproducible results, making it an essential tool for researchers studying the role of hnRNP L in gene expression regulation and other molecular mechanisms. With its high affinity and specificity, this monoclonal antibody offers exceptional sensitivity and accuracy in detecting hnRNP L in various biological samples. Whether you are investigating myostatin signaling pathways or exploring the functions of fibrinogen or lipoprotein lipase, the hnRNP L Antibody is an indispensable tool for your research needs. Trust this reliable antibody to provide accurate and consistent results that will advance your</p>

<p>Purified Rabbit polyclonal OSGEPL1 antibody</p>

<p>The PDK1 antibody is a monoclonal antibody that has been developed for use in the field of Life Sciences. It specifically targets alpha-fetoprotein, a protein that is expressed in various tissues including cardiomyocytes. The PDK1 antibody has been shown to have neutralizing effects on chemokines, which play a crucial role in inflammation and immune response. This antibody can be used as a research tool to study the function and regulation of chemokines in different biological processes. Additionally, the PDK1 antibody has been found to inhibit the activity of β-catenin, an important signaling molecule involved in cell proliferation and differentiation. This inhibition can have implications for cancer research and therapeutics development. The PDK1 antibody is produced using advanced techniques in monoclonal antibody production and undergoes rigorous quality control to ensure its efficacy and specificity. It is formulated with excipients that maintain its stability and functionality.</p>

<p>Affinity Purified Goat anti-Chicken IgY Fc Antibody. Please inquire for bulk pricing or custom conjugations.</p>

<p>Tetanus toxin antibody is a monoclonal antibody that acts as an inhibitor of the tetanus toxin. It belongs to the class of antibodies known as neutralizing antibodies, which are active agents in the field of life sciences. This monoclonal antibody specifically targets and neutralizes the effects of tetanus toxin by binding to it and preventing it from causing harm. Additionally, this antibody has been shown to have potential therapeutic applications in other areas, such as inhibiting the activity of epidermal growth factor (EGF) and atypical hemolytic autoantibodies. With its versatility and efficacy, this monoclonal antibody offers promising possibilities for medical research and treatment options.</p>

<p>HMBS antibody was raised using the middle region of HMBS corresponding to a region with amino acids SSLRRAAQLQRKFPHLEFRSIRGNLNTRLRKLDEQQEFSAIILATAGLQR</p>

<p>AHCYL1 antibody was raised using the N terminal of AHCYL1 corresponding to a region with amino acids MSMPDAMPLPGVGEELKQAKEIEDAEKYSFMATVTKAPKKQIQFADDMQE</p>

<p>Rabbit polyclonal PARP15 antibody</p>

<p>Rabbit polyclonal PP1 alpha antibody</p>

<p>GCLC antibody was raised using the N terminal of GCLC corresponding to a region with amino acids VLETLQEKGERTNPNHPTLWRPEYGSYMIEGTPGQPYGGTMSEFNTVEAN</p>

<p>The CD171 antibody is a monoclonal antibody that specifically targets the alpha-synuclein antigen. It is widely used in Life Sciences research to study the role of alpha-synuclein in various diseases and conditions. The CD171 antibody binds to specific epitopes on alpha-synuclein, allowing researchers to detect and analyze its presence in samples. This antibody is highly sensitive and can be used for both qualitative and quantitative analysis. Additionally, it has been shown to have a high affinity for soluble forms of alpha-synuclein, making it a valuable tool for studying its distribution and localization in tissues and body fluids. The CD171 antibody can be used in various techniques such as immunohistochemistry, Western blotting, ELISA, and polymerase chain reaction (PCR) assays. Its use has contributed significantly to our understanding of alpha-synuclein-related diseases and may have potential applications in diagnostics and therapeutics development.</p>

<p>PRAMEF10 antibody was raised using the middle region of PRAMEF10 corresponding to a region with amino acids DLLRHTGGLSKLGLELYPAPLESLDYKGHVNWEILTPIRAELMRTLREVR</p>

<p>The FAK antibody is a highly effective monoclonal antibody used in Life Sciences. It belongs to the family of antibodies targeting specific growth factors, such as trastuzumab and adalimumab. This antibody specifically targets CD33, a protein expressed on the surface of certain cells. By neutralizing CD33, the FAK antibody inhibits the growth and proliferation of these cells.</p>

<p>Purified Polyclonal Von Hippel Lindau antibody</p>

<p>Mouse monoclonal GBA3 antibody</p>

<p>Purified Polyclonal DNAJB11 antibody</p>

<p>The RAF1 antibody is a highly specific and activated monoclonal antibody that is used in various applications within the field of Life Sciences. This antibody specifically targets RAF1, a protein involved in the mitogen-activated protein kinase (MAPK) signaling pathway. It has been extensively tested and validated for its use in research studies.</p>

<p>Rabbit polyclonal NFKP p65 antibody</p>

<p>Rabbit polyclonal PKC epsilon antibody (Ser729)</p>

<p>Purified Polyclonal MGCRACGAP antibody</p>

<p>Calibrator for Cat ELISA Kit</p>

<p>The Tetracycline antibody is a highly specific monoclonal antibody that binds to tetracycline, a broad-spectrum antibiotic. This antibody has a high receptor binding affinity and can be used in various applications, such as polymerase chain reactions (PCR), immunohistochemistry, and Western blotting. It specifically targets tetracycline residues in biological samples, allowing for the detection and quantification of this antibiotic. In addition to its use in research, the Tetracycline antibody has potential applications in the field of medicine. It can be used to study the cellular localization of tetracycline within cells or tissues, providing valuable insights into its mechanism of action. Furthermore, this antibody can be utilized to investigate protein-protein interactions involving tetracycline or its derivatives. The Tetracycline antibody is produced using advanced techniques in monoclonal antibody production. It exhibits high specificity and sensitivity, ensuring reliable and accurate results. This antibody is compatible with various sample types, including</p>