Anticorps primaires

PRSS16 antibody was raised using a synthetic peptide corresponding to a region with amino acids SHSTPYCGLRRAVQIVLHSLGQKCLSFSRAETVAQLRSTEPQLSGVGDRQ

GABABR2 antibody was raised in rabbit using residues 42-54 [TRGAPRPPPSSPP] of the 105 kDa GABABR2 protein as the immunogen.

SHARPIN antibody was raised in rabbit using the C terminal of SHARPIN as the immunogen

Scamp5 antibody was raised in rabbit using the C terminal of Scamp5 as the immunogen

ZBTB26 antibody was raised in rabbit using the middle region of ZBTB26 as the immunogen

SEPN1 antibody was raised in rabbit using the C terminal of SEPN1 as the immunogen

HEY1 antibody was raised using the N terminal of HEY1 corresponding to a region with amino acids ALGSMSPTTSSQILARKRRRGIIEKRRRDRINNSLSELRRLVPSAFEKQG

BMPER antibody was raised using the C terminal of BMPER corresponding to a region with amino acids NGHKRDDLIGGDGNFKFDVDDFAESWRVESNEFCNRPQRKPVPELCQGTV

Arntl2 antibody was raised in rabbit using the C terminal of Arntl2 as the immunogen

Purified Polyclonal AKAP10 antibody

ISX antibody was raised in rabbit using the N terminal of ISX as the immunogen

ASB12 antibody was raised using the C terminal of ASB12 corresponding to a region with amino acids DDKGIALLLQARATPRSLLSQVRLVVRRALCQAGQPQAINQLDIPPMLIS

C1QTNF4 antibody was raised using the middle region of C1QTNF4 corresponding to a region with amino acids DEQRRPGARRAASQSAMLQLDYGDTVWLRLHGAPQYALGAPGATFSGYLV

HLA-DPA1 antibody was raised using the middle region of HLA-DPA1 corresponding to a region with amino acids EAQEPIQMPETTETVLCALGLVLGLVGIIVGTVLIIKSLRSGHDPRAQGT

ZNF565 antibody was raised in rabbit using the middle region of ZNF565 as the immunogen

ICAM1 antibody was raised in rabbit using highly pure recombinant human ICAM-1 as the immunogen.

TNF alpha antibody was raised in rabbit using highly pure recombinant human TNF-alpha as the immunogen.

PSENEN antibody was raised in rabbit using the C terminal of PSENEN as the immunogen

Purified Polyclonal FOXC1/2 antibody

ZDHHC19 antibody was raised using the N terminal of ZDHHC19 corresponding to a region with amino acids TLLTDATPLVKEPHPLPLVPRPWFLPSLFAAFNVVLLVFFSGLFFAFPCR

TCF25 antibody was raised in rabbit using the N terminal of TCF25 as the immunogen

TMEM158 antibody was raised using the middle region of TMEM158 corresponding to a region with amino acids AHGRAFFAAAFHRVGPPLLIEHLGLAAGGAQQDLRLCVGCGWVRGRRTGR

The STAT3 antibody is a monoclonal antibody that specifically targets the cytokine family. It has been extensively studied and validated using mass spectroscopy techniques in Life Sciences research. This antibody is designed to detect activated STAT3 in nuclear extracts, making it an essential tool for studying signaling pathways involving this transcription factor. The STAT3 antibody has been used in various applications such as chromatin immunoprecipitation assays to investigate its DNA binding activity and its role in gene regulation. Additionally, this antibody has shown anti-thrombotic properties and has been implicated in oxygen therapy research. Whether you're conducting basic research or exploring therapeutic avenues, the STAT3 antibody is a valuable tool for your studies. Choose from our range of high-quality monoclonal and polyclonal antibodies to meet your specific research needs.

The cSRC antibody is a valuable tool in the field of Life Sciences. It is widely used as an inhibitor for 6-phosphogluconate dehydrogenase, an enzyme involved in glucose metabolism. This antibody specifically targets and binds to the phosphorylation site of cSRC, a protein kinase that plays a crucial role in cell signaling pathways.

SERINC2 antibody was raised using the N terminal of SERINC2 corresponding to a region with amino acids VCEEGAGIPTVLQGHIDCGSLLGYRAVYRMCFATAAFFFFFTLLMLCVSS

Rab23 antibody was raised in rabbit using the middle region of Rab23 as the immunogen

Rabbit polyclonal CEB alpha antibody (Ser21)

The EGFR antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It is designed to specifically target and neutralize the epidermal growth factor receptor (EGFR), a protein that plays a crucial role in cell growth and division. This antibody can be used in various applications, such as chemiluminescent immunoassays, where it enables the detection and quantification of EGFR levels in samples.

The FABP5 antibody is a highly potent and cytotoxic monoclonal antibody that targets a specific molecule in the body. Antibodies are proteins produced by the immune system to recognize and neutralize foreign substances. This particular antibody has been extensively studied in the field of Life Sciences due to its ability to inhibit the activity of a ubiquitin ligase, which plays a crucial role in cellular processes.

The VCP antibody is a highly specialized antibody that targets various proteins involved in crucial cellular processes. It specifically recognizes β-catenin, c-myc, alpha-synuclein, and other nuclear proteins. This antibody is widely used in the field of Life Sciences for research purposes.

Please enquire for more information about HBsAg Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page

Please enquire for more information about Dengue Virus Type 1 Envelope Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page

Monoclonal antibody against RANKL; anti-resorptive agent for osteoperosis treatment

CA 125 antibody (biotin) was raised in mouse using affinity pure human CA 125 antigen as the immunogen.

Cortisol antibody was raised in mouse using cortisol-3 BSA as the immunogen.