Anticorps primaires

The AURKA antibody is a monoclonal antibody that targets glial fibrillary acidic protein (GFAP). It is commonly used in research and diagnostics to detect the presence of GFAP, which is an important marker for astrocytes. This antibody can be used in various applications, including immunohistochemistry, western blotting, and flow cytometry. Additionally, it has been shown to be effective in detecting amyloid plaques in Alzheimer's disease brain tissue. The AURKA antibody is also useful for studying the role of protein kinases in cellular processes, as it specifically targets Aurora kinase A (AURKA). It can be used as a tool to inhibit the activity of AURKA and study its downstream effects on cell division and proliferation. In summary, the AURKA antibody is a valuable tool for researchers in the life sciences field who are studying various aspects of cellular biology and disease mechanisms.

GCNT3 antibody was raised using a synthetic peptide corresponding to a region with amino acids AICVYGAGDLNWMLQNHHLLANKFDPKVDDNALQCLEEYLRYKAIYGTEL

Affinity purified Rabbit polyclonal RASSF2 antibody

The TRIM32 antibody is a powerful tool used in the field of Life Sciences. It is an antibody that specifically targets and binds to TRIM32, a protein involved in various cellular processes. This antibody has been extensively studied and proven to be effective in various applications.

FZD9 antibody was raised using a synthetic peptide corresponding to a region with amino acids RPPGDLGPGAGGSGTCENPEKFQYVEKSRSCAPRCGPGVEVFWSRRDKDF

Rabbit polyclonal RECK antibody

ACOX2 antibody was raised in Rabbit using Human ACOX2 as the immunogen

The Desmin antibody is an important tool in the field of Life Sciences. It is a monoclonal antibody that specifically targets Desmin, a protein involved in muscle cell structure and function. This antibody has been widely used in research to study the role of Desmin in various biological processes.

The Pleiotrophin antibody is a highly versatile and reactive chemokine that plays a crucial role in various biological processes. This antibody is available as both polyclonal and monoclonal forms, offering researchers flexibility in their experimental designs. It has been extensively studied in the field of Life Sciences due to its ability to neutralize the effects of Pleiotrophin, thereby modulating cellular functions.

Affinity purified Rabbit polyclonal NT5C2 antibody

AKR1C3 antibody was raised in Rabbit using Human AKR1C3 as the immunogen

Affinity purified Rabbit polyclonal POLR2B antibody

FSCN1 antibody was raised in Rabbit using Human FSCN1 as the immunogen

The ALDH1A2 antibody is a highly specialized product in the field of Life Sciences and Antibodies. It is specifically designed to target and interact with ALDH1A2, a growth factor that plays a crucial role in various biological processes. This antibody has been extensively tested and validated for its effectiveness in detecting and quantifying ALDH1A2 levels.

The RAP1 antibody is a highly effective monoclonal antibody that specifically targets and neutralizes the activated form of RAP1. This antibody has been extensively tested and proven to be highly efficient in various applications such as lysis, immobilization, and electrode-based assays. It is widely used in Life Sciences research for its ability to inhibit interferon-induced cytotoxicity and promote endothelial growth. The RAP1 antibody is also known for its high affinity towards anti-dnp antibodies, making it an excellent tool for detecting and quantifying these specific antibodies in human serum samples. With its exceptional specificity and reliability, the RAP1 antibody is a valuable asset for any researcher or scientist working in the field of immunology or molecular biology.

VWF antibody (HRP) was raised in sheep using Rat vWF purified from plasma as the immunogen.

EME1 antibody was raised in Rabbit using Human EME1 as the immunogen

The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug belonging to the rifamycins class. It is specifically designed to target tuberculosis infections and contains active compounds that exhibit bactericidal activity. This drug has been extensively studied using advanced techniques such as transcription-quantitative polymerase chain and patch-clamp technique, which have shown its efficacy in inhibiting bacterial growth. Additionally, it undergoes various metabolic transformations including hydrolysis by esterases, oxidation by cytochrome p450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Its ability to bind to markers expressed in Mycobacterium tuberculosis strains further enhances its effectiveness in inhibiting cell growth.

Rabbit polyclonal PRSS8 antibody

FEN1 antibody was raised in Rabbit using Human FEN1 as the immunogen

IL6 antibody is a highly effective therapeutic agent that targets interleukin-6 (IL-6), a key cytokine involved in inflammatory responses. IL-6 plays a crucial role in various physiological processes, including immune response and inflammation. This antibody specifically binds to IL-6, preventing its interaction with its receptors and inhibiting downstream signaling pathways.

Rabbit polyclonal POLR3A antibody

Affinity purified Rabbit polyclonal Glycine dehydrogenase antibody

CD32 antibody (Fab'2) was raised in mouse using human K562 tumor cells and L cells tranfected with human Fc gamma RII as the immunogen.

Affinity purified Rabbit polyclonal AMPK gamma 2 antibody

The FZD6 antibody is a powerful diagnostic agent and inhibitor that belongs to the class of polyclonal antibodies. It plays a crucial role in the field of life sciences, particularly in inhibiting tumor cell growth. This antibody specifically targets lactate, excitotoxicity, extracellular proteins, MIP-1β, fibrinogen, and serine protease. Its unique properties make it an excellent diagnostic biomarker for various medical conditions. With its ability to inhibit the growth of tumor cells, this antibody holds great promise in the development of new and effective medicines.

Affinity purified Rabbit polyclonal SHARP2 antibody

The SYN1 antibody is a highly specialized immunoassay tool used in Life Sciences research. It is a polyclonal antibody that specifically targets SYN1, a protein involved in natriuretic signaling pathways. This antibody can be used in various applications such as Western blotting, immunohistochemistry, and enzyme-linked immunosorbent assays (ELISA). The SYN1 antibody is designed to detect the presence of SYN1 in pharmaceutical preparations and biological samples. It can be used to study the role of SYN1 in different cellular processes, including dopamine release, hypoxia-inducible factor-1 activation, and cytochrome P450 oxidoreductase activity. Researchers can use this antibody to investigate the effects of rapamycin treatment on SYN1 expression and function. With its high specificity and sensitivity, the SYN1 antibody is an invaluable tool for scientists studying the intricate mechanisms of cellular signaling pathways.

CD5 antibody (FITC) was raised in mouse using feline CD5 as the immunogen.

Affinity purified Rabbit polyclonal PON2 antibody

The Aminoacylase 1 antibody is a highly active agent that targets glycogen synthase kinase. It falls under the category of Life Sciences and is classified as a Polyclonal Antibody. This antibody has been shown to activate oxygen uptake and is commonly used in the field of medicine. It serves as a serum marker and is particularly effective in high-flux assays. The Aminoacylase 1 antibody can also be used in conjunction with other antibodies such as anti-mesothelin or interferon-stimulated gene antibodies. Additionally, it has been found to have methyl transferase properties. With its wide range of applications, this antibody is an invaluable tool for researchers in various scientific disciplines.

ENO1 antibody was raised in Rabbit using Human ENO1 as the immunogen

The Spermidine synthase antibody is a monoclonal antibody that specifically targets the tyrosine residue in interleukin-6 (IL-6). It is a highly specific and sensitive tool used in Life Sciences research to detect and quantify IL-6 levels in various biological samples. This antibody has been extensively validated for its specificity, sensitivity, and reproducibility.

The IL4 antibody is a pegylated monoclonal antibody that is used in the field of Life Sciences as a medicament. It has been extensively studied for its glycation properties, particularly in human serum. The IL4 antibody can be immobilized onto a carbon electrode and used in electrochemical detection methods. It has also been used in conjunction with adeno-associated viruses to deliver therapeutic antibodies directly to specific cells or tissues. Additionally, the IL4 antibody has been shown to bind to actin filaments and can be labeled with phalloidin for visualization purposes. With its wide range of applications and specificity, the IL4 antibody is a valuable tool in various research fields.

Affinity purified Rabbit polyclonal SHKBP1 antibody

GSTZ1 antibody was raised in Rabbit using Human GSTZ1 as the immunogen

CHD9 antibody was raised in Rabbit using Human CHD9 as the immunogen

Affinity purified Rabbit polyclonal Cytokeratin 34 antibody

ATP6V1G2 antibody was raised in rabbit using the middle region of ATP6V1G2 as the immunogen

TMEM24 antibody was raised using the C terminal Of Tmem24 corresponding to a region with amino acids AGLSQSHDDLSNATATPSVRKKAGSFSRRLIKRFSFKSKPKANGNPSPQL

Rat monoclonal CD144 antibody (PE)

Please enquire for more information about Dengue Virus Type 1 Envelope Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page

Monoclonal antibody against RANKL; anti-resorptive agent for osteoperosis treatment

CA 125 antibody (biotin) was raised in mouse using affinity pure human CA 125 antigen as the immunogen.

Cortisol antibody was raised in mouse using cortisol-3 BSA as the immunogen.