Anticorps primaires
Sous-catégories appartenant à la catégorie "Anticorps primaires"
- Anticorps pour la recherche sur le cancer(3.620 produits)
- Anticorps cardio-vasculaires(2 produits)
- Biologie du développement(751 produits)
- Anticorps relatifs à l’épigénétique(162 produits)
- Anticorps d'immunologie(2.551 produits)
- Anticorps du métabolisme(279 produits)
- Anticorps de microbiologie(739 produits)
- Transduction du signal(2.717 produits)
- Tags & Marqueurs cellulaires(33 produits)
75447 produits trouvés pour "Anticorps primaires"
DHX15 antibody
DHX15 antibody was raised using a synthetic peptide corresponding to a region with amino acids YINIRKALVTGYFMQVAHLERTGHYLTVKDNQVVQLHPSTVLDHKPEWVLSTRBP antibody
STRBP antibody was raised using the middle region of STRBP corresponding to a region with amino acids PSKKTAKLHVAVKVLQAMGYPTGFDADIECMSSDEKSDNESKNETVSSNSADAD2 antibody
ADAD2 antibody was raised using the middle region of ADAD2 corresponding to a region with amino acids GQQLHDCHGLVIARRALLRFLFRQLLLATQGGPKGKEQSVLAPQPGPGPPGoat anti Monkey IgM (Alk Phos)
Goat anti-monkey IgM (Alk Phos) was raised in goat using monkey IgM as the immunogen.FARS2 antibody
FARS2 antibody was raised using the N terminal of FARS2 corresponding to a region with amino acids VELLGKSYPQDDHSNLTRKVLTRVGRNLHNQQHHPLWLIKERVKEHFYKQ
RPE antibody
RPE antibody was raised using the middle region of RPE corresponding to a region with amino acids MMVSKPEQWVKPMAVAGANQYTFHLEATENPGALIKDIRENGMKVGLAIK
DYSFIP1 antibody
DYSFIP1 antibody was raised using the middle region of DYSFIP1 corresponding to a region with amino acids DHIRQGDLEQVGRFIRTRKVSLATIHPSGLAALHEAVLSGNLECVKLLVKClaudin 17 antibody
Claudin 17 antibody was raised using the middle region of CLDN17 corresponding to a region with amino acids KQVQCTGSNERAKAYLLGTSGVLFILTGIFVLIPVSWTANIIIRDFYNPA
NOD2 antibody
The NOD2 antibody is a highly specialized protein used in the field of Life Sciences. It acts as an inhibitory factor for growth factors such as epidermal growth factor and hepatocyte growth factor. This monoclonal antibody specifically targets NOD2, a receptor involved in immune responses and inflammation. By binding to NOD2, the antibody blocks its function and prevents the activation of downstream signaling pathways. This antibody has been extensively studied and shown to be effective in various research applications, including the study of autoimmune diseases, cancer biology, and immunology. Whether you need a polyclonal or monoclonal antibody, our high-quality NOD2 antibodies are reliable tools for your research needs.
Ibuprofen antibody
The Ibuprofen antibody is a highly specialized antibody that targets and binds to Ibuprofen, a popular nonsteroidal anti-inflammatory drug (NSAID). This antibody has been extensively studied in the field of Life Sciences and has shown promising results in various research applications.
GPR45 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is specifically designed to combat tuberculosis infection by targeting the active compounds responsible for its growth. This bactericidal activity is achieved by binding to DNA-dependent RNA polymerase, effectively preventing transcription and replication. Extensive research has been conducted using advanced techniques like transcription-quantitative polymerase chain and patch-clamp technique to confirm its high efficacy on human erythrocytes. Metabolically, this drug undergoes various transformations including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it exhibits a strong affinity for markers expressed in Mycobacterium tuberculosis strains, inhibiting their growth in culture. Experience the power of 6-Fluoro
NeuroD antibody
The NeuroD antibody is a highly specialized monoclonal antibody that has been developed for research purposes in the field of Life Sciences. It is specifically designed to target and detect the presence of NeuroD, a protein that plays a crucial role in various cellular processes. This antibody has been extensively tested and validated for its specificity and sensitivity, making it an ideal tool for studying the function and expression of NeuroD in different biological systems.VHL antibody
The VHL antibody is a multidrug monoclonal antibody that specifically targets molecules involved in endothelial growth. It is widely used in Life Sciences research to study the role of growth factors, chemokines, and other signaling molecules in various cellular processes. This antibody has been shown to effectively neutralize the activity of activated growth factors, leading to a decrease in cell proliferation and migration. Additionally, it has demonstrated cytotoxic effects on cancer cells through its ability to induce cell death via various mechanisms, including hybridization and cell cytotoxicity. The VHL antibody is an essential tool for researchers studying angiogenesis, tumor biology, and therapeutic development.
Doublecortin antibody
The Doublecortin antibody is a highly specialized antibody that is activated by plasmin activity. It is commonly used in Life Sciences research to study protein-protein interactions and proteolytic processes. This antibody specifically targets hepcidin, a peptide hormone involved in iron metabolism, and has been shown to have neuroprotective effects. Additionally, the Doublecortin antibody has been found to inhibit glutamate-induced cell cytotoxicity and fibrinogen binding. It is available as both a monoclonal and polyclonal antibody, allowing researchers to choose the best option for their specific needs. With its high specificity and ability to target specific amino acid residues, the Doublecortin antibody is a valuable tool in various research applications.CD49b antibody (Azide Free)
CD49b antibody (Azide free) was raised in rat using RIL-2-propagated NK1.1+ cells from C57BL/6 mice as the immunogen.CCT6B antibody
CCT6B antibody was raised using a synthetic peptide corresponding to a region with amino acids VARTSLQTKVHAELADVLTEVVVDSVLAVRRPGYPIDLFMVEIMEMKHKL
GFAP antibody
GFAP antibody was raised in mouse using intermediate filament cytoskeleton from cultured human glioma cells as the immunogen.NT5DC1 antibody
NT5DC1 antibody was raised using the N terminal of NT5DC1 corresponding to a region with amino acids EWKHFLSDTGMACRSGKYYFYDNYFDLPGALLCARVVDYLTKLNNGQKTFJAB1 antibody
The JAB1 antibody is a highly specialized product in the field of Life Sciences. It is an anti-mesothelin antibody that specifically binds to mesothelin, a protein involved in cell growth and differentiation. This antibody has been extensively studied and shown to have neutralizing properties against mesothelin, making it a valuable tool for research purposes.
CD72.1 antibody
CD72.1 antibody was raised in mouse using DBA/2 murine spleen cells as the immunogen.APP antibody
The APP antibody is a powerful tool used in medical research and diagnostics. It specifically targets alpha-fetoprotein (AFP), which is an important biomarker for various diseases, including liver cancer. The APP antibody binds to amyloid plaques, which are abnormal protein deposits found in the brains of individuals with Alzheimer's disease. This antibody can also be used to study growth factors and their binding proteins, providing valuable insights into cellular processes and signaling pathways.
C6ORF134 antibody
C6ORF134 antibody was raised using the middle region of C6Orf134 corresponding to a region with amino acids DDREAHNEVEPLCILDFYIHESVQRHGHGRELFQYMLQKERVEPHQLAID
ZDHHC21 antibody
ZDHHC21 antibody was raised using the middle region of ZDHHC21 corresponding to a region with amino acids ELLTCYALMFSFCHYYYFLPLKKRNLDLFVFRHELAIMRLAAFMGITMLVNucleobindin 1 antibody
Nucleobindin 1 antibody was raised using the C terminal of NUCB1 corresponding to a region with amino acids PAAHPEGQLKFHPDTDDVPVPAPAGDQKEVDTSEKKLLERLPEVEVPQHLGRIN2B antibody
GRIN2B antibody was raised using the middle region of GRIN2B corresponding to a region with amino acids RSPDHKRYFRDKEGLRDFYLDQFRTKENSPHWEHVDLTDIYKERSDDFKRDegré de pureté :Min. 95%REM1 antibody
REM1 antibody was raised using a synthetic peptide corresponding to a region with amino acids SDSEGSWEALYRVVLLGDPGVGKTSLASLFAGKQERDLHEQLGEDVYERTHSPG2 antibody
The HSPG2 antibody is a monoclonal antibody that has various applications in the field of Life Sciences. It has been extensively studied for its role in osteopontin regulation and e-cadherin expression. Additionally, this antibody has shown potential in targeting amyloid plaque formation and inhibiting oncostatin activity.
NUDT21 antibody
NUDT21 antibody was raised using a synthetic peptide corresponding to a region with amino acids TGWPRGVTQFGNKYIQQTKPLTLERTINLYPLTNYTFGTKEPLYEKDSSVMCM3 antibody
The MCM3 antibody is a powerful tool in the field of Life Sciences. It is a monoclonal antibody that specifically targets MCM3, a protein biomarker involved in various cellular processes. This antibody can be used in immunoassay tests to detect and quantify MCM3 levels in samples, providing valuable insights into cell cycle regulation, DNA replication, and other essential biological functions.
HDAC1 antibody
The HDAC1 antibody is a highly specialized product in the field of Life Sciences. It is a glycopeptide that specifically targets and binds to the HDAC1 protein, which plays a crucial role in gene expression regulation. This antibody is available as both polyclonal and monoclonal antibodies, providing researchers with options based on their specific experimental needs.MGC46336 antibody
MGC46336 antibody was raised in rabbit using the N terminal of MGC46336 as the immunogenDegré de pureté :Min. 95%HBcAg antibody
The HBcAg antibody is a reactive antibody that is used in various applications in the field of life sciences. It is commonly used for its neutralizing properties against antiphospholipid antibodies and anti-HER2 antibodies. This polyclonal antibody has been extensively studied and has shown high specificity and affinity towards its target antigens.
AMFR antibody
AMFR antibody was raised using the C terminal of AMFR corresponding to a region with amino acids FGEVEVEPSEVEDFEARGSRFSKSADERQRMLVQRKDELLQQARKRFLNK
GRP75 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections due to its bactericidal activity. By binding to DNA-dependent RNA polymerase, this drug inhibits bacterial growth by preventing transcription and replication. Its potency has been demonstrated through extensive research using the patch-clamp technique on human erythrocytes. Metabolized through various metabolic transformations, including hydrolysis, oxidation, reduction, and conjugation, it specifically targets markers expressed in Mycobacterium tuberculosis strains and inhibits their cell growth. Trust 6-Fluoro-3-indoxyl-beta-D-galactopyranoside for its remarkable effectiveness against tuberculosis.PPP1R7 antibody
PPP1R7 antibody was raised using a synthetic peptide corresponding to a region with amino acids QNLIKCIENLEELQSLRELDLYDNQIKKIENLEALTELEILDISFNLLRNTBC1D22A antibody
TBC1D22A antibody was raised using the N terminal of TBC1D22A corresponding to a region with amino acids RQGRPTLQEGPGLQQKPRPEAEPPSPPSGDLRLVKSVSESHTSCPAESASFMR1 antibody
FMR1 antibody was raised in Mouse using a purified recombinant fragment of human FMR1 expressed in E. coli as the immunogen.AADAC antibody
AADAC antibody was raised using a synthetic peptide corresponding to a region with amino acids NYGSSELAKKYPGFLDVRAAPLLADDNKLRGLPLTYVITCQYDLLRDDGLARHGEF19 antibody
ARHGEF19 antibody was raised using a synthetic peptide corresponding to a region with amino acids RFLLNSVLYQEYSDVASARELRRQQREEEGPGDEAEGAEEGPGPPRANLSCHRNB2 antibody
CHRNB2 antibody was raised using a synthetic peptide corresponding to a region with amino acids CKIEVKHFPFDQQNCTMKFRSWTYDRTEIDLVLKSEVASLDDFTPSGEWDBLK antibody
BLK antibody was raised in Mouse using a purified recombinant fragment of BLK expressed in E. coli as the immunogen.VDAC3 antibody
VDAC3 antibody was raised using the N terminal of VDAC3 corresponding to a region with amino acids KWNTDNTLGTEISWENKLAEGLKLTLDTIFVPNTGKKSGKLKASYKRDCFCXCL9 antibody (Biotin)
Please enquire for more information about CXCL9 antibody (Biotin) including the price, delivery time and more detailed product information at the technical inquiry form on this pageNONO antibody
NONO antibody was raised using the C terminal of NONO corresponding to a region with amino acids DGTLGLTPPTTERFGQAATMEGIGAIGGTPPAFNRAAPGAEFAPNKRRRYORC2 antibody
The ORC2 antibody is a highly effective tool in the field of life sciences. It is an activated polyclonal antibody that specifically targets endocytic uptake. This antibody can be used in various applications, including immunohistochemistry, western blotting, and flow cytometry. The ORC2 antibody is also available as a monoclonal antibody for more specific targeting. It has been extensively tested and proven to have high affinity and specificity for its target antigen. Additionally, this antibody has been found to be highly effective in neutralizing the cytotoxic effects of certain pathogens, such as Bacillus thuringiensis. Its colloidal properties allow for easy conjugation with other molecules, making it a versatile tool for research purposes. With its ability to interfere with interferon signaling pathways and modulate fatty acid metabolism, the ORC2 antibody opens up new possibilities for studying these biological processes.Flt1 antibody
Flt1 antibody was raised in mouse using recombinant human FLT1/VEGFR1 protein EC-domain as the immunogen.C3orf33 antibody
C3orf33 antibody was raised using the middle region of C3orf33 corresponding to a region with amino acids NSALFCYLLVSKGGYFSVNLNEEILRRGLGKTVLVKGLKYDSKIYWTVHR
