Anticorps primaires

IFITM3 antibody was raised in Rabbit using Human IFITM3 as the immunogen

FARS2 antibody was raised using the N terminal of FARS2 corresponding to a region with amino acids VELLGKSYPQDDHSNLTRKVLTRVGRNLHNQQHHPLWLIKERVKEHFYKQ

RPE antibody was raised using the middle region of RPE corresponding to a region with amino acids MMVSKPEQWVKPMAVAGANQYTFHLEATENPGALIKDIRENGMKVGLAIK

ACTR10 antibody was raised in Rabbit using Human ACTR10 as the immunogen

Claudin 17 antibody was raised using the middle region of CLDN17 corresponding to a region with amino acids KQVQCTGSNERAKAYLLGTSGVLFILTGIFVLIPVSWTANIIIRDFYNPA

Rabbit polyclonal NOP56 antibody

The NOD2 antibody is a highly specialized protein used in the field of Life Sciences. It acts as an inhibitory factor for growth factors such as epidermal growth factor and hepatocyte growth factor. This monoclonal antibody specifically targets NOD2, a receptor involved in immune responses and inflammation. By binding to NOD2, the antibody blocks its function and prevents the activation of downstream signaling pathways. This antibody has been extensively studied and shown to be effective in various research applications, including the study of autoimmune diseases, cancer biology, and immunology. Whether you need a polyclonal or monoclonal antibody, our high-quality NOD2 antibodies are reliable tools for your research needs.

The Ibuprofen antibody is a highly specialized antibody that targets and binds to Ibuprofen, a popular nonsteroidal anti-inflammatory drug (NSAID). This antibody has been extensively studied in the field of Life Sciences and has shown promising results in various research applications.

The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is specifically designed to combat tuberculosis infection by targeting the active compounds responsible for its growth. This bactericidal activity is achieved by binding to DNA-dependent RNA polymerase, effectively preventing transcription and replication. Extensive research has been conducted using advanced techniques like transcription-quantitative polymerase chain and patch-clamp technique to confirm its high efficacy on human erythrocytes. Metabolically, this drug undergoes various transformations including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it exhibits a strong affinity for markers expressed in Mycobacterium tuberculosis strains, inhibiting their growth in culture. Experience the power of 6-Fluoro

DCX antibody was raised in Rabbit using Human DCX as the immunogen

The VHL antibody is a multidrug monoclonal antibody that specifically targets molecules involved in endothelial growth. It is widely used in Life Sciences research to study the role of growth factors, chemokines, and other signaling molecules in various cellular processes. This antibody has been shown to effectively neutralize the activity of activated growth factors, leading to a decrease in cell proliferation and migration. Additionally, it has demonstrated cytotoxic effects on cancer cells through its ability to induce cell death via various mechanisms, including hybridization and cell cytotoxicity. The VHL antibody is an essential tool for researchers studying angiogenesis, tumor biology, and therapeutic development.

Affinity purified Rabbit polyclonal KLRC4 antibody

ROCK2 antibody was raised in rabbit using the middle region of ROCK2 as the immunogen

Rabbit polyclonal RPS14 antibody (biotin)

Affinity purified Rabbit polyclonal ENTPD6 antibody

CCT6B antibody was raised using a synthetic peptide corresponding to a region with amino acids VARTSLQTKVHAELADVLTEVVVDSVLAVRRPGYPIDLFMVEIMEMKHKL

The JAB1 antibody is a highly specialized product in the field of Life Sciences. It is an anti-mesothelin antibody that specifically binds to mesothelin, a protein involved in cell growth and differentiation. This antibody has been extensively studied and shown to have neutralizing properties against mesothelin, making it a valuable tool for research purposes.

The APP antibody is a powerful tool used in medical research and diagnostics. It specifically targets alpha-fetoprotein (AFP), which is an important biomarker for various diseases, including liver cancer. The APP antibody binds to amyloid plaques, which are abnormal protein deposits found in the brains of individuals with Alzheimer's disease. This antibody can also be used to study growth factors and their binding proteins, providing valuable insights into cellular processes and signaling pathways.

C6ORF134 antibody was raised using the middle region of C6Orf134 corresponding to a region with amino acids DDREAHNEVEPLCILDFYIHESVQRHGHGRELFQYMLQKERVEPHQLAID

FLOT1 antibody was raised in Rabbit using Human FLOT1 as the immunogen

Affinity purified Rabbit polyclonal PRPS2 antibody

The HSPG2 antibody is a monoclonal antibody that has various applications in the field of Life Sciences. It has been extensively studied for its role in osteopontin regulation and e-cadherin expression. Additionally, this antibody has shown potential in targeting amyloid plaque formation and inhibiting oncostatin activity.

Rabbit polyclonal ZNF397 antibody

The MCM3 antibody is a powerful tool in the field of Life Sciences. It is a monoclonal antibody that specifically targets MCM3, a protein biomarker involved in various cellular processes. This antibody can be used in immunoassay tests to detect and quantify MCM3 levels in samples, providing valuable insights into cell cycle regulation, DNA replication, and other essential biological functions.

The HBcAg antibody is a reactive antibody that is used in various applications in the field of life sciences. It is commonly used for its neutralizing properties against antiphospholipid antibodies and anti-HER2 antibodies. This polyclonal antibody has been extensively studied and has shown high specificity and affinity towards its target antigens.

Affinity purified Rabbit polyclonal HHIP antibody

AMFR antibody was raised using the C terminal of AMFR corresponding to a region with amino acids FGEVEVEPSEVEDFEARGSRFSKSADERQRMLVQRKDELLQQARKRFLNK

Affinity purified Mouse polyclonal XRCC1 antibody

Rabbit Polyclonal elF4E antibody (Ser209)

Affinity purified Rabbit polyclonal Neuregulin 2 antibody

Rabbit polyclonal Claudin 6 antibody (Tyr219)