Anticorps primaires

Rabbit polyclonal PSMD13 antibody

Rabbit polyclonal MAPK1/2 antibody (Thr202/Tyr204)

CHRNE antibody was raised in rabbit using the N terminal of CHRNE as the immunogen

The SEMA4A antibody is a polyclonal antibody that specifically targets the protein SEMA4A, which belongs to the family of costimulatory molecules. This antibody can be used in various life sciences applications, including immunomodulatory research and dendritic cell studies. By binding to SEMA4A, this antibody can inhibit its interaction with membrane-bound receptors, thereby modulating immune responses. The SEMA4A antibody is a valuable tool for researchers studying the role of costimulatory molecules in immune regulation and developing novel immunotherapies.

Affinity purified Rabbit polyclonal DPYD antibody

Donkey anti-rat IgG (H + L) (Fab'2) (PE) was raised in donkey using Rat IgG (H&L) as the immunogen.

LAT2 antibody was raised in Rabbit using Human LAT2 as the immunogen

GABABR2 antibody was raised in rabbit using residues 42-54 [TRGAPRPPPSSPP] of the 105 kDa GABABR2 protein as the immunogen.

CHCHD6 antibody was raised in Rabbit using Human CHCHD6 as the immunogen

FAM120A antibody was raised in Rabbit using Human FAM120A as the immunogen

IL6 antibody is a highly effective therapeutic agent that targets interleukin-6 (IL-6), a key cytokine involved in inflammatory responses. IL-6 plays a crucial role in various physiological processes, including immune response and inflammation. This antibody specifically binds to IL-6, preventing its interaction with its receptors and inhibiting downstream signaling pathways.

Affinity purified Rabbit polyclonal GLE1 antibody

The CBS antibody is a highly specialized product in the field of Life Sciences. It falls under the category of antibodies and is specifically designed for human serum. This antibody exhibits cytotoxic properties, making it an effective tool for various applications such as immunohistochemistry, flow cytometry, and Western blotting.

EXOSC5 antibody was raised in Rabbit using Human EXOSC5 as the immunogen

Peptide YY antibody is a calcitonin-like peptide that plays a role in regulating pancreatic insulin secretion. It is an activated and stable analogue of the peptide YY hormone. This antibody has been used in various studies in Life Sciences to investigate its effects on cholinergic and thyrotropin-releasing hormone-induced insulin secretion. Peptide YY antibody has also been utilized in research involving microinjection and subthreshold dose experiments, as well as the use of antisense oligodeoxynucleotides. This polyclonal antibody binds specifically to peptide YY, allowing for the detection and analysis of this hormone in different experimental settings.

The DCI antibody is a cytotoxic monoclonal antibody that specifically targets mesothelin, a protein expressed on the surface of certain cancer cells. It is used in Life Sciences research to study the role of mesothelin in various diseases and as a potential therapeutic target. The DCI antibody has been shown to inhibit the growth of cancer cells and induce cell death through multiple mechanisms. Additionally, it has been found to have low cross-reactivity with human serum proteins, minimizing potential side effects. This high-quality antibody is widely used in scientific research and holds great promise for future therapeutic applications.

The DUSP22 antibody is a powerful tool used in the field of Life Sciences. It belongs to the class of interferon antibodies that specifically target and bind to DUSP22, a protein involved in various cellular processes. This antibody is designed to recognize specific polypeptide sequences found in DUSP22 and can be used for research purposes such as studying its expression levels or investigating its role in different biological pathways.

Rabbit polyclonal CXCL11 antibody (FITC)

Rabbit polyclonal TROVE2 antibody

The Annexin A5 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It is designed to target and detect the presence of annexin, a protein involved in various cellular processes such as apoptosis and inflammation. This antibody specifically binds to annexin, allowing researchers to study its role in different biological systems.

Annexin A5 antibody was raised using the N terminal of ANXA5 corresponding to a region with amino acids SELTGKFEKLIVALMKPSRLYDAYELKHALKGAGTNEKVLTEIIASRTPE

EPHA2 antibody was raised in Rabbit using Human EPHA2 as the immunogen

Rat thymocyte antibody was raised in rabbit using RBC-free rat thymocytes as the immunogen.

ANXA5 antibody was raised in Rabbit using Human ANXA5 as the immunogen

IL3 antibody is a polyclonal antibody that specifically targets and binds to IL3, a cytokine involved in the regulation of hematopoiesis. This antibody has been shown to effectively disrupt the interaction between IL3 and its receptor, leading to the inhibition of downstream signaling pathways. It can be used for various applications, such as immunohistochemistry, immunofluorescence, and western blotting. The IL3 antibody has high affinity and specificity for IL3, ensuring reliable and accurate detection. Whether you're studying the role of IL3 in cancer progression or investigating its potential as a therapeutic target, this antibody is an essential tool for your research. With its robust performance and consistent results, the IL3 antibody will help advance your understanding of hematopoiesis and contribute to scientific breakthroughs in the field.

Rabbit polyclonal STA13 antibody

Podoplanin antibody was raised in mouse using gp36 (podoplanin)-expressing MDCK cells as the immunogen.

The S100A11 antibody is a polyclonal antibody that is used in Life Sciences research. It is specifically designed to neutralize the activity of S100A11 protein in human serum. This antibody is colloidal and activated, making it highly effective in cross-linking with other antibodies or proteins. The S100A11 antibody can be used in various applications, such as Western blotting, immunohistochemistry, and ELISA assays. It has been shown to effectively bind to the target protein complex and induce lysis of cells expressing high levels of S100A11. Additionally, this antibody has been found to have potential therapeutic applications due to its ability to inhibit the production of extracellular polysaccharides.

Rabbit polyclonal PIP5K3 antibody

Rabbit polyclonal RPA2 antibody (FITC)

Mouse monoclonal MIF4GD antibody

Rabbit polyclonal PTGES2 antibody

CD62E antibody was raised in mouse using human CD62E/E-selectin as the immunogen.

The XRCC4 antibody is a highly specific monoclonal antibody that has an inhibitory effect on the progesterone concentration in human serum. It exhibits strong antioxidant activity and has been shown to neutralize autoantibodies and anti-drug antibodies. The XRCC4 antibody is widely used in various assays, particularly in Life Sciences research, for its ability to detect and quantify specific proteins of interest. This monoclonal antibody is colloidal gold-labeled, making it suitable for use in immunohistochemical staining and other applications requiring high sensitivity and specificity. Additionally, the XRCC4 antibody has been found to be effective in detecting granulosa cell tumors due to its binding affinity with mesothelin, a protein commonly expressed in these types of tumors. Its versatility and reliability make it an essential tool for researchers studying steroid hormones and related biological processes.

Rat monoclonal CD45R antibody (FITC)

The GPR171 antibody is a highly specialized monoclonal antibody that targets the GPR171 receptor. This receptor plays a crucial role in various biological processes, including erythropoietin signaling, TNF-α production, chemokine regulation, and microvessel density. The GPR171 antibody has been extensively studied and proven to be highly effective in neutralizing the activity of GPR171.

Please enquire for more information about HBsAg Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page

Please enquire for more information about Dengue Virus Type 1 Envelope Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page

Monoclonal antibody against RANKL; anti-resorptive agent for osteoperosis treatment

CA 125 antibody (biotin) was raised in mouse using affinity pure human CA 125 antigen as the immunogen.

Cortisol antibody was raised in mouse using cortisol-3 BSA as the immunogen.