Anticorps primaires

Rabbit polyclonal cJun antibody

FFAR2 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.

Purified Rabbit polyclonal EPHA4 antibody (Tyr596)

LNPEP antibody was raised in Rabbit using Human LNPEP as the immunogen

MPP5 antibody was raised using a synthetic peptide corresponding to a region with amino acids AVDCPGDLGTRMMPIRRSAQLERIRQQQEDMRRRREEEGKKQELDLNSSM

GPT antibody was raised in Rabbit using Human GPT as the immunogen

ZNF326 antibody was raised in rabbit using the C terminal of ZNF326 as the immunogen

NHP2L1 antibody was raised in Rabbit using Human NHP2L1 as the immunogen

CD154 antibody (FITC) was raised in hamster using activated murine Th1 clone D1.6 as the immunogen.

SLC26A10 antibody was raised in rabbit using the N terminal of SLC26A10 as the immunogen

SITPEC antibody was raised in rabbit using the middle region of SITPEC as the immunogen

CD3G antibody was raised in Rabbit using Human CD3G as the immunogen

CD45RB antibody (biotin) was raised in rat using cloned murine Th2 cell lines as the immunogen.

STK11 antibody was raised in rabbit using the C terminal of STK11 as the immunogen

FGD2 antibody was raised in Rabbit using Human FGD2 as the immunogen

Rabbit anti-guinea pig IgG (H+L) (Rhodamine) was raised in rabbit using guinea pig IgG whole molecule as the immunogen.

The PARP2 antibody is a cytotoxic monoclonal antibody used in Life Sciences research. It is designed to target and bind to the PARP2 protein, which plays a crucial role in DNA repair and cell survival. This antibody can be immobilized on an electrode or used in various assays to study the interaction between PARP2 and other molecules.

ASNA1 antibody was raised in rabbit using the C terminal of ASNA1 as the immunogen

The PSAP antibody is a growth factor antigen that plays a crucial role in various biological processes. It is an essential tool in the field of Life Sciences, particularly in antibody research. The PSAP antibody is available in both polyclonal and monoclonal forms, providing researchers with options to suit their specific needs.

Mouse monoclonal KCNAB1 antibody

PTGS1 antibody was raised using the middle region of PTGS1 corresponding to a region with amino acids GFTKALGHGVDLGHIYGDNLERQYQLRLFKDGKLKYQVLDGEMYPPSVEE

The HES1 antibody is a potent medicament that belongs to the class of antibodies. It specifically targets and neutralizes the activity of interferon-gamma (IFN-gamma), a growth factor involved in various cellular processes. This monoclonal antibody has been shown to inhibit the expression and function of urokinase plasminogen activator (uPA), which is responsible for thrombocytopenia and other clotting disorders. Additionally, the HES1 antibody has cytotoxic effects on cells expressing alpha-fetoprotein, a marker commonly found in certain types of cancer. Through its binding to the plasminogen activator receptor, this antibody disrupts signal transduction pathways involving tyrosine kinases, leading to impaired cell proliferation and survival. The HES1 antibody is widely used in Life Sciences research for its ability to modulate immune responses and investigate IFN-gamma-related diseases.

The PGD antibody is a monoclonal antibody used in Life Sciences research. It specifically targets and binds to alpha-fetoprotein, a protein that is associated with various diseases and conditions. The PGD antibody has been extensively tested and proven to be highly specific and sensitive in detecting alpha-fetoprotein in human serum samples. It can be used for various applications such as ELISA, Western blotting, immunohistochemistry, and flow cytometry. The PGD antibody can also be conjugated with different markers or enzymes for enhanced detection and visualization. With its high affinity and cytotoxic properties, the PGD antibody holds great potential for targeted therapy in the future.

GNB2 antibody was raised using a synthetic peptide corresponding to a region with amino acids CCRFLDDNQIITSSGDTTCALWDIETGQQTVGFAGHSGDVMSLSLAPDGR

Rabbit polyclonal RAB41 antibody

EBAG9 antibody was raised in Rabbit using Human EBAG9 as the immunogen

GJC3 antibody was raised in rabbit using the middle region of GJC3 as the immunogen

CD102 antibody (PE) was raised in rat using COS cells transfected with mouse ICAM-2 cDNA as the immunogen.

HHIPL1 antibody was raised in rabbit using the C terminal of HHIPL1 as the immunogen

Mouse monoclonal CD19 antibody (PE)

Rabbit polyclonal PLDN antibody

NNMT antibody was raised using the N terminal of NNMT corresponding to a region with amino acids MESGFTSKDTYLSHFNPRDYLEKYYKFGSRHSAESQILKHLLKNLFKIFC

Bbs1 antibody was raised in rabbit using the N terminal of Bbs1 as the immunogen

LOC400856 antibody was raised using the C terminal of LOC400856 corresponding to a region with amino acids SLHTSPRAEGAGSGLSQPQRRALTAQGGAEGLLERGQSGHGGRGGAKSER

IFNGR1 antibody was raised in Rabbit using Human IFNGR1 as the immunogen

Rabbit polyclonal TIA1 antibody

The EPHA3 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It targets the fatty acid receptor EPHA3, which plays a crucial role in various cellular processes such as cell growth and differentiation. This antibody has been extensively studied and validated for its ability to specifically bind to EPHA3, making it an essential tool for researchers working in this area.

Mouse monoclonal MICAL1 antibody

CD69 antibody (biotin) was raised in hamster using Y245 murine dendritic epidermal T cell line as the immunogen.

NUDT6 antibody was raised in rabbit using the middle region of NUDT6 as the immunogen

Affinity purified Goat anti Human IgG antibody

CCNL2 antibody was raised in Rabbit using Human CCNL2 as the immunogen

Rabbit polyclonal SGTA antibody

SEPN1 antibody was raised in rabbit using the C terminal of SEPN1 as the immunogen

LDHAL6A antibody was raised in Rabbit using Human LDHAL6A as the immunogen