Anticorps primaires

BMPER antibody was raised using the C terminal of BMPER corresponding to a region with amino acids NGHKRDDLIGGDGNFKFDVDDFAESWRVESNEFCNRPQRKPVPELCQGTV

Affinity purified Rabbit polyclonal Calcium binding protein p22 antibody

This antibody reacts with heavy (gamma) chains on rabbit IgG and light chains on all rabbit immunoglobulins.

Rabbit polyclonal SYT1 antibody (Ser309)

The GLUT4 antibody is a glycoprotein that plays a crucial role in glucose metabolism. It is activated by androgen and protein kinase, leading to the translocation of GLUT4 from intracellular vesicles to the plasma membrane. This enables the uptake of glucose into cells, regulating blood sugar levels. The GLUT4 antibody can be used for various applications, including research in human serum, detection of autoantibodies, growth factor studies, anti-angiogenesis research, and as an essential tool for the development of antibodies in Life Sciences. With both polyclonal and monoclonal antibodies available, this product provides researchers with reliable options for their experiments. Additionally, it can be used as an inhibitor to study the function and regulation of GLUT4 in different cellular processes.

The FZD8 antibody is a diagnostic reagent that plays a crucial role in the field of Life Sciences. It is an antigen-specific antibody that specifically targets and binds to the FZD8 protein. This antibody is widely used in various research applications, including immunohistochemistry, western blotting, and flow cytometry.

Affinity purified Rabbit polyclonal CLIC3 antibody

RRM1 antibody was raised using the C terminal of RRM1 corresponding to a region with amino acids MHFYGWKQGLKTGMYYLRTRPAANPIQFTLNKEKLKDKEKVSKEEEEKER

Donkey anti-rat IgG (H + L) (FITC) was raised in donkey using Rat IgG (H&L) as the immunogen.

The IGF2BP2 antibody is a highly specialized antibody that targets the transferrin receptor in the nucleus of cells. This antibody is widely used in Life Sciences research to study various cellular processes, including exocytosis, cell signaling, and protein synthesis. The IGF2BP2 antibody specifically binds to the antigen on the cell surface and facilitates the internalization of transferrin into the cell. This process is crucial for proper iron metabolism and cellular homeostasis. Additionally, this monoclonal antibody has been shown to have antimicrobial properties against certain bacteria, such as those expressing alpha-gal epitopes. Its unique mechanism of action involves targeting bacterial phosphatases and inhibiting their activity, leading to impaired bacterial growth. With its high specificity and potency, the IGF2BP2 antibody is an invaluable tool for researchers in various fields of study.

HBXIP antibody was raised using the N terminal of HBXIP corresponding to a region with amino acids EPGAGHLDGHRAGSPSLRQALCDGSAVMFSSKERGRCTVINFVPLEAPLR

Affinity purified Rabbit polyclonal ADCK4 antibody

Rabbit polyclonal POF1B antibody

The IL13 antibody is a monoclonal antibody that specifically targets IL-13, a cytokine involved in various immune responses and inflammatory processes. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in fluorescence-activated cell sorting (FACS) experiments. It has a molecular weight suitable for complex formation and can effectively inhibit the activity of IL-13.

The Synaptotagmin antibody is a highly specialized polyclonal antibody that is used in various assays and experiments in the field of Life Sciences. This antibody has the unique ability to neutralize the activity of glucose-6-phosphate, making it an essential tool for studying the role of this molecule in cellular processes. The Synaptotagmin antibody is available in both monoclonal and polyclonal forms, providing researchers with options to suit their specific needs. With its high affinity and specificity, this antibody can be used for a wide range of applications, including immunohistochemistry, Western blotting, and flow cytometry. Whether you are studying protein-protein interactions or investigating disease mechanisms, the Synaptotagmin antibody is an indispensable tool for your research. Trust in its reliability and accuracy to deliver accurate and reproducible results every time.

TNFRSF25 antibody was raised in rabbit using the middle region of TNFRSF25 as the immunogen

Loricrin antibody was raised using the N terminal of LOR corresponding to a region with amino acids GYSGGGCGGGSSGGGGGGGIGGCGGGSGGSVKYSGGGGSSGGGSGCFSSG

The LGALS3BP antibody is a monoclonal antibody that has been developed for use in various applications within the field of Life Sciences. It specifically targets LGALS3BP, a protein involved in multiple cellular processes including cell signaling, immune response, and cancer progression.

Affinity purified Rabbit polyclonal ATP5G1 antibody

ATP1B3 antibody was raised in Rabbit using Human ATP1B3 as the immunogen

The CCR5 antibody is a monoclonal antibody that has been widely used in Life Sciences research. It targets the CCR5 receptor, a glycoprotein found on the surface of immune cells. This antibody has been shown to have neutralizing effects on CCR5, blocking its interaction with the ligands and inhibiting viral entry into host cells. It has been used in various immunoassays and hybridoma cell studies to investigate the role of CCR5 in immune response and disease progression. Additionally, this antibody has been utilized for its potential antiviral properties, particularly against HIV-1 strains that use CCR5 as a co-receptor for viral entry. Its specificity and high affinity make it a valuable tool for studying CCR5-related signaling pathways and developing therapeutic strategies targeting this receptor.

FGF23 antibody is a highly specialized antibody used in the field of Life Sciences. It specifically targets FGF23, a glycosylated protein involved in mineralization regulation. The FGF23 antibody has been developed to neutralize the activity of FGF23, making it an essential tool for researchers studying bone and mineral metabolism. This antibody is produced using advanced techniques, including colloidal gold labeling or microsphere conjugation, ensuring high specificity and sensitivity. Whether used in immunoassays or as a research tool, the FGF23 antibody provides valuable insights into the role of FGF23 and its signaling pathways, including protein kinase and 3-kinase activation.

Mouse monoclonal UNG antibody

Rabbit polyclonal NDF2 antibody

Affinity purified Rabbit polyclonal PDIR antibody

The C-peptide antibody is a synthetic, recombinant protein that has been activated for use in various life sciences assays. This antibody is specifically designed to detect and bind to C-peptide, a protein fragment that is cleaved from proinsulin during insulin synthesis. The C-peptide antibody can be used in electrophoresis and other laboratory techniques to study the presence and function of C-peptide in human serum samples. This monoclonal antibody is highly specific and has been extensively characterized for its performance and reliability. It can be used as a valuable tool in research and diagnostic applications related to diabetes, insulin secretion, and related disorders. With its buffered formulation and high sensitivity, the C-peptide antibody ensures accurate and reproducible results in various experimental settings. Trust this antibody for your research needs in the field of endocrinology and beyond.

The CFOS antibody is a highly specialized antibody that has antiangiogenic properties. It is commonly used in Life Sciences research to study the formation of new blood vessels and their role in various biological processes. The CFOS antibody works by inhibiting the pro-angiogenic activity of certain proteins, such as epidermal growth factor, that are involved in promoting blood vessel growth. This monoclonal antibody binds specifically to CFOS, a basic protein that plays a key role in regulating cell growth and differentiation. By targeting CFOS, the CFOS antibody can effectively block the formation of new blood vessels and inhibit tumor growth. It is available as both a polyclonal and monoclonal antibody, providing researchers with options for their specific experimental needs. With its high specificity and cytotoxic effects on endothelial cells, the CFOS antibody has proven to be a valuable tool in studying angiogenesis and developing potential anti-cancer therapies.

The PRMT5 antibody is a highly effective inhibitor that specifically targets protein kinase activity. This monoclonal antibody has been extensively tested and validated by Life Sciences experts to ensure its efficacy. It can be used in various applications such as immunoassays, Western blotting, and immunohistochemistry.

Rabbit polyclonal GABRB2 antibody

FAM3C antibody was raised in Rabbit using Human FAM3C as the immunogen

Affinity purified Rabbit polyclonal PEX13 antibody

The STIP1 antibody is a highly specialized monoclonal antibody that targets the glial fibrillary acidic protein (GFAP). It can be used in immunoassays to detect and quantify GFAP in various biological samples. This antibody specifically recognizes the amino group of GFAP, allowing for accurate and sensitive detection. The STIP1 antibody has been extensively validated and is widely used in life sciences research. It is commonly used in studies involving epidermal growth factor (EGF) signaling pathways, as well as in the development of anti-HER2 antibodies. With its high specificity and sensitivity, this antibody offers researchers a valuable tool for studying GFAP-related processes and diseases.

Rabbit polyclonal ADORA2B antibody

Cytokeratin 8 antibody is a neutralizing monoclonal antibody that targets collagen. It is used in Life Sciences research to study the role of cytokeratin 8 in various cellular processes. This antibody can specifically bind to cytokeratin 8, which is an intermediate filament protein found in epithelial cells. By targeting cytokeratin 8, this antibody can help researchers investigate its interactions with other proteins such as e-cadherin and β-catenin, as well as its involvement in signaling pathways mediated by growth factors like epidermal growth factor and TGF-beta. Additionally, the use of this antibody has been shown to correlate with changes in microvessel density and activation of certain cellular processes. With its high specificity and affinity for cytokeratin 8, this antibody is a valuable tool for studying the biology of epithelial cells and their associated diseases.

The RPB8 antibody is an acidic monoclonal antibody that belongs to the colony-stimulating factor family. It is widely used in life sciences research for its ability to specifically bind to RPB8, a subunit of RNA polymerase II. This antibody has been shown to have toxic effects on cancer cells and can be used in various applications such as Western blotting, immunohistochemistry, and flow cytometry. The RPB8 antibody can also be used in combination with other antibodies, such as alpha-fetoprotein or vasoactive intestinal peptide, to study their interactions and signaling pathways. Additionally, this antibody has been shown to modulate the activity of phosphatases and interferons, making it a valuable tool for studying cellular processes and immune responses.

This antibody reacts with heavy chains on human IgG (gamma chain) and light chains on all human immunoglobulins.

Rabbit polyclonal ZNF774 antibody

The SLC6A1 antibody is a highly specialized monoclonal antibody that is used in Life Sciences research. It has been specifically designed to target and bind to the SLC6A1 protein, also known as the glycine transporter 1. This protein plays a crucial role in the transport of glycine, an important neurotransmitter involved in synaptic signaling.

EIF4EBP2 antibody was raised in Rabbit using Human EIF4EBP2 as the immunogen

Purified Rabbit polyclonal AurA antibody (Ser342)

Affinity purified Rabbit polyclonal RPA32 antibody

The Nestin antibody is a powerful tool for researchers in the field of Life Sciences. This polyclonal antibody specifically targets and binds to Nestin, an intermediate filament protein that is commonly used as a marker for neural stem cells. The antibody has been extensively tested and validated for its specificity and sensitivity in various applications, including immunohistochemistry, western blotting, and flow cytometry.

Affinity purified Rat polyclonal CD132 antibody

The PKR1 antibody is a highly specialized chemokine that is activated in various Life Sciences applications. This antibody has been extensively studied and proven to be effective in targeting fatty acids and growth factors. It is a monoclonal antibody that specifically targets the PKR1 receptor, which plays a crucial role in cell signaling pathways. The PKR1 antibody has shown remarkable results in inhibiting the growth of cancer cells, including MCF-7 breast cancer cells, by blocking the epidermal growth factor receptor pathway. Additionally, it has been used as an anti-CD33 antibody to target leukemia cells and as a mesenchymal stem cell inhibitor for research purposes. With its potent activity and specificity, the PKR1 antibody is a valuable tool for researchers working in the field of molecular biology and drug discovery.

The HAX1 antibody is an antiviral medication that acts as an inhibitor of methyl transferase. It plays a crucial role in the regulation of interleukin and serves as a serum marker in Life Sciences. This biomarker composition has been shown to be effective in detecting autoantibodies and is widely used in high-flux monoclonal antibody therapy. The HAX1 antibody is a potent medicament that targets specific cation channels and carnitine, making it an essential component for various medical applications. With its remarkable efficacy and versatility, the HAX1 antibody offers promising solutions for combating viral infections and promoting overall health.

KLC3 antibody was raised using the middle region of KLC3 corresponding to a region with amino acids MLNILALVYRDQNKYKEATDLLHDALQIREQTLGPEHPAVAATLNNLAVL

Affinity purified Rabbit polyclonal APRT antibody

Purified Polyclonal ATP8 antibody

RAD23A antibody was raised using a synthetic peptide corresponding to a region with amino acids  VPSSGSSGREEDAASTLVTGSEYETMLTEIMSMGYERERVVAALRASYNN

Affinity purified Rabbit polyclonal ALPL antibody

Please enquire for more information about HBsAg Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page

Please enquire for more information about Dengue Virus Type 1 Envelope Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page

Monoclonal antibody against RANKL; anti-resorptive agent for osteoperosis treatment

CA 125 antibody (biotin) was raised in mouse using affinity pure human CA 125 antigen as the immunogen.

Cortisol antibody was raised in mouse using cortisol-3 BSA as the immunogen.