Anticorps primaires

MAP3K15 antibody was raised using the middle region of MAP3K15 corresponding to a region with amino acids TLEQKTQELYHLQLKLKSNCITENPAGPYGQRTDKELIDWLRLQGADAKT

UCHL5IP antibody was raised using the middle region of UCHL5IP corresponding to a region with amino acids LLDTIRSLTIGCSSCSSLMEHFEDTREKNEALLGELFSSPHLQMLLNPEC

The MALT1 antibody is a highly specialized and immobilized antibody that plays a crucial role in various biological processes. It is particularly effective in detecting and targeting the activated form of interferon-gamma (IFN-gamma), which is an essential antigen involved in immune response regulation. Additionally, this antibody has been shown to interact with growth factors and participate in sumoylation, a process that modifies proteins for specific cellular functions.

The Vimentin protein antibody is a powerful tool for conducting antigen-antibody reactions in various research applications. This antibody specifically targets the vimentin protein, which plays a vital role in maintaining cell structure and integrity. It can be used to study vimentin expression levels, localization, and interactions with other proteins.

The SFTPD antibody is a substance that belongs to the group of antibodies. It is commonly used in gas-liquid interface studies and has been shown to have antinociceptive properties, meaning it can inhibit pain sensation. In Life Sciences, this antibody is often used as an inhibitor to study the function of specific proteins or pathways. Additionally, the SFTPD antibody has been used in research related to collagen and its role in diseases and therapeutics. It is a polyclonal antibody, meaning it recognizes multiple epitopes on its target protein. This makes it a versatile tool for various applications, including vaccine strain development and the development of new medicines.

The Cyclin D1 antibody is a globulin-based neutralizing antibody that specifically targets Cyclin D1, a protein involved in cell cycle regulation. This antibody has been extensively studied and proven to effectively inhibit the activity of Cyclin D1, making it a valuable tool for research purposes.

Purified Rabbit polyclonal HLAH antibody

Rabbit polyclonal PLCL2 antibody

DPPA5 antibody was raised using the N terminal of DPPA5 corresponding to a region with amino acids MGTLPARRHIPPWVKVPEDLKDPEVFQVQTRLLKAIFGPDGSRIPYIEQV

Affinity purified Rabbit polyclonal BXDC1 antibody

The Citrate Synthetase Antibody is a powerful tool used in Life Sciences research. This antibody specifically targets and binds to citrate synthetase, an enzyme involved in the Krebs cycle. By binding to this enzyme, the antibody allows for the detection and analysis of citrate synthetase levels in various biological samples.

Rabbit polyclonal ABL1 antibody (Tyr412)

Rabbit polyclonal GRM7 antibody (Ser862)

Affinity purified Rabbit polyclonal Histamine H2 Receptor antibody

Rabbit polyclonal WRKY27.1 antibody

CCND1 antibody was raised in rabbit using the middle region of CCND1 as the immunogen

WDR23 antibody was raised using the N terminal of WDR23 corresponding to a region with amino acids GSRNSSSAGSGSGDPSEGLPRRGAGLRRSEEEEEEDEDVDLAQVLAYLLR

Donkey anti-sheep IgG (H + L) (FITC) was raised in donkey using sheep IgG (H&L) as the immunogen.

Affinity purified Rabbit polyclonal RAMP1 antibody

The Annexin A3 antibody is an essential antibody-drug that plays a crucial role in various biological processes. It specifically targets and binds to Annexin A3, a protein involved in glucagon receptor binding and antigen presentation. This antibody is available in both polyclonal and monoclonal forms, offering versatility for different research applications.

Affinity purified Rabbit polyclonal PCCB antibody

The AML1 antibody is a highly specialized Polyclonal Antibody used in immunosuppressant therapies. It is designed to target protein-protein interactions involving AML1, a transcription factor that plays a crucial role in the development of various blood cells. This antibody is derived from colloidal gold and calmodulin, ensuring its high specificity and affinity for AML1. The monoclonal nature of this antibody allows for precise targeting and binding to AML1-expressing cells.

The AQP1 antibody is a highly activated steroid monoclonal antibody that is commonly used in the field of Life Sciences. It specifically targets the AQP1 protein, which plays a crucial role in regulating water transport across cell membranes. This antibody can be used for various applications, including Western blotting, immunohistochemistry, and flow cytometry.

The CtBP2 antibody is a highly specialized antibody that targets the anti-ICOS antibodies. It specifically binds to serum albumin protein and agonist proteins, effectively neutralizing their activity. This antibody has been extensively tested in various laboratory settings, including liver microsomes and drug antibody assays. It has shown potent chemokine-neutralizing properties, making it an essential tool for researchers in the life sciences field. The CtBP2 antibody is available in both polyclonal and monoclonal forms, providing flexibility for different experimental setups. Its activation potential and ability to target autoantibodies and growth factors make it a valuable asset in research studies.

human NPY1R C-terminal peptide immunoge, Affinity purified Rabbit polyclonal NPY1R antibody, lyophilized

CD25 antibody (Azide free) was raised in rat using IL-2-dependent BALB/c mouse helper T-cell as the immunogen.

Rabbit polyclonal HNRPH1 antibody

Affinity purified Rabbit polyclonal PTPN11 antibody

Troponin T Type 2 antibody was raised using a synthetic peptide corresponding to a region with amino acids ESKPKPRSFMPNLVPPKIPDGERVDFDDIHRKRMEKDLNELQALIEAHFE

Affinity purified Rabbit polyclonal Serpina 4 antibody

BBS5 antibody was raised using the middle region of BBS5 corresponding to a region with amino acids VEIDSDGHTDAFVAYFADGNKQQDREPVFSEELGLAIEKLKDGFTLQGLW

ARL8B antibody was raised in Rabbit using Human ARL8B as the immunogen

The gp340 antibody is a highly specialized monoclonal antibody that is designed to target and neutralize specific proteins in the body. It has been extensively tested and proven effective in various research studies conducted by Life Sciences professionals. This antibody specifically targets influenza hemagglutinin, a protein that plays a crucial role in the growth and spread of the influenza virus.

Affinity purified Rabbit polyclonal STRA8 antibody

The Ibuprofen antibody is a highly specialized monoclonal antibody used in Life Sciences research. It is designed to target and bind specifically to Ibuprofen, a nonsteroidal anti-inflammatory drug commonly used for pain relief and reducing inflammation. This antibody can be used in various assays, including nuclear and GAPDH assays, to detect the presence and levels of Ibuprofen in samples.

Affinity purified Rabbit polyclonal DRD1 antibody

Rabbit polyclonal TNAP1 antibody

Affinity purified Rabbit polyclonal USP47 antibody

FAM13C1 antibody was raised using the N terminal of FAM13C1 corresponding to a region with amino acids TEHVVSSQSECQVRAGTPAHESPQNNAFKCQETVRLQPRIDQRTAISPKD

CACNB4 antibody was raised using the C terminal of CACNB4 corresponding to a region with amino acids LEAYWRATHTTSSTPMTPLLGRNLGSTALSPYPTAISGLQSQRMRHSNHS

Rabbit polyclonal CCR5 antibody (Ser336)

Rabbit polyclonal ADCY7 antibody

The STX1A antibody is a versatile diagnostic reagent and medicament that belongs to the group of antibodies. It specifically targets β-catenin, a growth factor involved in various cellular processes. The STX1A antibody can be used in research and clinical settings for the detection and quantification of β-catenin levels. It has been shown to exhibit high specificity and sensitivity in antigen-antibody reactions, making it a reliable tool in the field of Life Sciences. The STX1A antibody is available as a monoclonal antibody conjugated with magnetic particles or microparticles, enabling easy separation and purification of target proteins. With its exceptional binding affinity and selectivity, the STX1A antibody is an indispensable tool for studying granulosa cell function and other biological processes.

Rabbit polyclonal SENP6 antibody

DIDO1 antibody was raised in Rabbit using Human DIDO1 as the immunogen

PNPLA3 antibody was raised using the C terminal of PNPLA3 corresponding to a region with amino acids CSPKGCPAETKAEATPRSILRSSLNFFLGNKVPAGAEGLSTFPSFSLEKS

APBB2 antibody was raised in Rabbit using Human APBB2 as the immunogen

Mouse monoclonal DTNA antibody

Influenza Virus Ns1A Binding Protein antibody was raised using the N terminal of IVNS1ABP corresponding to a region with amino acids RAVLACCSPYLFEIFNSDSDPHGISHVKFDDLNPEAVEVLLNYAYTAQLK

The AQP5 antibody is a monoclonal antibody used in Life Sciences research. It specifically targets and binds to the amide form of aquaporin 5 (AQP5), a water channel protein involved in various biological processes. This antibody has been widely used to study the role of AQP5 in different cell types, including helicobacter, granulosa cells, and more. Additionally, it has shown reactivity with e-cadherin, a cell adhesion molecule that plays a crucial role in tissue organization and development. The AQP5 antibody can be utilized for immunohistochemistry, western blotting, and other experimental techniques to investigate the expression and function of AQP5 and its interaction with other proteins. Its high specificity and sensitivity make it an essential tool for researchers studying cellular mechanisms and potential therapeutic targets related to aquaporins.

Please enquire for more information about Dengue Virus Type 1 Envelope Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page

Please enquire for more information about HBsAg Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page

Monoclonal antibody against RANKL; anti-resorptive agent for osteoperosis treatment

CA 125 antibody (biotin) was raised in mouse using affinity pure human CA 125 antigen as the immunogen.

Cortisol antibody was raised in mouse using cortisol-3 BSA as the immunogen.