Anticorps primaires

The Fatty Acid Synthase antibody is a highly specialized protein used in Life Sciences research. It is an essential tool for studying the role of fatty acid synthesis in various biological processes. This antibody specifically targets and neutralizes proteins involved in the synthesis of fatty acids, such as TNF-α, interleukin-6, and chemokines.

Affinity purified Rabbit polyclonal Ran BP1 antibody

Rabbit polyclonal GABRA5 antibody

The SNAP23 antibody is a monoclonal antibody that specifically targets the protein SNAP23. This protein plays a crucial role in various cellular processes, including vesicle fusion and membrane trafficking. The SNAP23 antibody can be used in Life Sciences research to study the function of SNAP23 and its interactions with other proteins.

Rabbit polyclonal U1A antibody (biotin)

Affinity purified Rabbit polyclonal Dipeptidyl peptidase 3 antibody

MKRN1 antibody was raised using the N terminal of MKRN1 corresponding to a region with amino acids GDRCRYEHSKPLKQEEATATELTTKSSLAASSSLSSIVGPLVEMNTGEAE

GNAI1 antibody was raised using a synthetic peptide corresponding to a region with amino acids YQLNDSAAYYLNDLDRIAQPNYIPTQQDVLRTRVKTTGIVETHFTFKDLH

Rabbit polyclonal Galectin 7 antibody

TFG antibody is a monoclonal antibody that specifically targets amyloid plaque, a hallmark of various neurodegenerative diseases. This antibody recognizes and binds to the TFG glycoprotein, which is present in amyloid plaques. By binding to these plaques, the TFG antibody helps to clear them from the brain and reduce their accumulation.

Rabbit polyclonal Ephrin A4 antibody

GEM antibody was raised using the C terminal of GEM corresponding to a region with amino acids FSSLPLGREAVEAAVKEAGYTIEWFEVISQSYSSTMANNEGLFSLVARKL

Mouse monoclonal Influenza A haemagglutinin H1 antibody

The DDX3Y antibody is a polyclonal antibody that has minimal toxicity and is widely used in the field of Life Sciences. It plays a crucial role in various biological processes, including colony-stimulating factor production, chemokine signaling, and immune response modulation. This antibody can be used for cytometry analysis to detect the presence of DDX3Y protein in cells or tissues.

Crystallin Mu antibody was raised using the middle region of CRYM corresponding to a region with amino acids AHINAVGASRPDWRELDDELMKEAVLYVDSQEAALKESGDVLLSGAEIFA

The DDC antibody is a powerful tool in the field of Life Sciences. It is an antibody that can be used for various applications, including research and diagnostic purposes. This antibody is highly specific and can recognize and bind to a target protein called DDC (dopa decarboxylase). DDC is an enzyme that plays a crucial role in the synthesis of important neurotransmitters like dopamine.

The PAX6 antibody is a growth factor that belongs to the class of monoclonal antibodies. It is designed to target and neutralize the PAX6 protein, which plays a crucial role in various biological processes. This antibody has been extensively studied and validated in Life Sciences research, making it a reliable tool for scientists and researchers. It can be used in experiments involving adipose tissue, nuclear signaling pathways, and other cellular processes where PAX6 is involved. The PAX6 antibody is also available as polyclonal antibodies for different applications, including the detection of chemokines, angptl3 inhibitors, and alpha-fetoprotein. With its high specificity and effectiveness, this antibody is an essential tool for studying PAX6-related mechanisms and exploring their potential therapeutic applications.

ACAD9 antibody was raised in Rabbit using Human ACAD9 as the immunogen

Rabbit polyclonal RPAP2 antibody

Rabbit polyclonal ST8SIA2 antibody

STUB1 antibody was raised using the C terminal of STUB1 corresponding to a region with amino acids VDEKRKKRDIPDYLCGKISFELMREPCITPSGITYDRKDIEEHLQRVGHF

The c-Jun antibody is a powerful tool used in Life Sciences research. It is a monoclonal antibody that specifically targets and binds to the c-Jun protein. This protein plays a crucial role in various cellular processes, including fibronectin production, endothelial growth, and the regulation of interleukin-6 and epidermal growth factor.

BBS5 antibody was raised using the middle region of BBS5 corresponding to a region with amino acids VEIDSDGHTDAFVAYFADGNKQQDREPVFSEELGLAIEKLKDGFTLQGLW

The CROT antibody is a highly specialized monoclonal antibody that targets autoantibodies and has antiviral properties. It is commonly used in high-flux assays and life science research to detect and measure the levels of interleukins, carnitine, and octanoyltransferase. This antibody is designed to specifically bind to CROT protein, inhibiting its activity and preventing the formation of antibodies that can cause autoimmune diseases. With its ability to accurately detect extracellular antibodies, the CROT antibody plays a crucial role in the development of new medicines and therapies targeting autoimmune disorders.

Rabbit polyclonal SYT17 antibody

Affinity purified Rabbit polyclonal Dyrk3 antibody

Delangin B antibody was raised in Rat using Delangin peptide coupled carrier protein as the immunogen.

The PKR antibody is a highly specialized antibody used in Life Sciences research. It targets the protein kinase R (PKR), which plays a crucial role in cellular responses to viral infection and stress. This antibody is designed to specifically bind to PKR, allowing researchers to detect and study its activity in various biological samples.

NAP1L1 antibody was raised in Rabbit using Human NAP1L1 as the immunogen

The LTBR antibody is a highly effective tool in the field of Life Sciences. It specifically targets and inhibits the activity of glycoproteins involved in various cellular processes. This polyclonal antibody has been extensively studied and shown to have potent cytotoxic effects on activated cells. Additionally, it has been found to interfere with the p38 mitogen-activated protein kinase (MAPK) pathway, a key signaling pathway involved in cell proliferation and survival.

IL2 antibody was raised in goat using highly pure recombinant human IL-2 as the immunogen.

The GPX7 antibody is a highly specialized monoclonal antibody that is used in various Life Sciences applications. It is specifically designed to target and neutralize GPX7, an enzyme that plays a crucial role in the regulation of oxidative stress. The antibody has been extensively tested and validated for its efficacy in laboratory experiments.

Affinity purified Rabbit polyclonal RASSF1 antibody

The MYPN antibody is a retinoid that belongs to the class of antibodies. It specifically targets 6-phosphogluconate dehydrogenase and has antinociceptive properties. This monoclonal antibody is widely used in the field of Life Sciences and has been shown to inhibit methyl transferase activity. The MYPN antibody also plays a crucial role in collagen synthesis and can be used as an inhibitor for HDAC (histone deacetylase) enzymes. It is commonly used in the development of medicines and vaccines, particularly against nuclear-related diseases. Additionally, this polyclonal antibody has been shown to enhance acetylation processes and is effective against vaccine strains.

The BARHL2 antibody is a highly specialized product used in the field of Life Sciences. It plays a crucial role in various biological processes, including the regulation of dopamine and nuclear receptor signaling pathways. This antibody has been extensively studied and proven to be effective in blocking the interaction between domperidone and metoclopramide with their respective receptors.

CYP2E1 antibody was raised in rabbit using a synthetic peptide as the immunogen.

Mouse monoclonal DNAJB1 antibody

Insulin antibody is a highly specialized product used in Life Sciences research. It is an activated polyclonal antibody that specifically targets insulin. This antibody is widely used in immunohistochemistry studies to detect and visualize insulin expression in tissues. It has also been shown to have neutralizing activity against insulin, making it a valuable tool for studying the role of insulin in various biological processes.

Rabbit polyclonal CDC25B antibody (Ser323)

Rabbit polyclonal PKC pan antibody (Thr497)

The PRDX6 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It specifically targets and binds to the protein peroxiredoxin 6 (PRDX6), which plays a crucial role in various cellular processes. This antibody has been extensively studied and proven to be effective in research involving cholinergic signaling, electrode development, and protein kinase studies.

ARHGAP25 antibody was raised using the middle region of ARHGAP25 corresponding to a region with amino acids SPGEEASALSSQACDSKGDTLASPNSETGPGKKNSGEEEIDSLQRMVQEL

Affinity purified Rabbit polyclonal PEX26 antibody

The SYNCRIP antibody is a protein-based product that falls under the category of antibodies. It is specifically designed for use in life sciences research and has potential therapeutic applications. This polyclonal antibody is highly effective in targeting and binding to the SYNCRIP protein, enabling researchers to study its functions and interactions within cells. With its high specificity and sensitivity, this antibody is an invaluable tool for scientists working in various fields such as molecular biology, cell biology, and biochemistry. Whether you are investigating gene expression regulation or studying protein-protein interactions, the SYNCRIP antibody is a reliable choice that will help advance your research efforts.

Affinity purified Rabbit polyclonal Glypican 5 antibody

Affinity purified Rabbit polyclonal IL1F9 antibody

Biotin Conjugated Rabbit anti-Goat IgG h+l antibody.

Affinity purified Rabbit polyclonal PDYN antibody

CK1 delta antibody was raised using the middle region of CSNK1D corresponding to a region with amino acids NLVYIIDFGLAKKYRDARTHQHIPYRENKNLTGTARYASINTHLGIEQSR

Rabbit polyclonal CLPT1 antibody

CDC23 antibody was raised in Rabbit using Human CDC23 as the immunogen

Rabbit polyclonal VATPase G1 antibody (HRP)

Monoclonal antibody against RANKL; anti-resorptive agent for osteoperosis treatment

Please enquire for more information about HBsAg Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page

Please enquire for more information about Dengue Virus Type 1 Envelope Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page

CA 125 antibody (biotin) was raised in mouse using affinity pure human CA 125 antigen as the immunogen.

Cortisol antibody was raised in mouse using cortisol-3 BSA as the immunogen.