Anticorps primaires
Sous-catégories appartenant à la catégorie "Anticorps primaires"
- Anticorps pour la recherche sur le cancer(3.721 produits)
- Anticorps cardio-vasculaires(2 produits)
- Biologie du développement(764 produits)
- Anticorps relatifs à l’épigénétique(162 produits)
- Anticorps d'immunologie(2.585 produits)
- Anticorps du métabolisme(286 produits)
- Anticorps de microbiologie(741 produits)
- Transduction du signal(2.765 produits)
- Tags & Marqueurs cellulaires(34 produits)
75562 produits trouvés pour "Anticorps primaires"
C Peptide antibody
C Peptide antibody was raised in mouse using human C-peptide-BSA as the immunogen.Degré de pureté :>95% Pure By Sds-PageNR0B1 antibody
NR0B1 antibody was raised using the N terminal of NR0B1 corresponding to a region with amino acids TSSKQTHVAPAAPEARPGGAWWDRSYFAQRPGGKEALPGGRATALLYRCC
Desmin antibody
The Desmin antibody is an important tool in the field of Life Sciences. It is a monoclonal antibody that specifically targets Desmin, a protein involved in muscle cell structure and function. This antibody has been widely used in research to study the role of Desmin in various biological processes.
Pleiotrophin antibody
The Pleiotrophin antibody is a highly versatile and reactive chemokine that plays a crucial role in various biological processes. This antibody is available as both polyclonal and monoclonal forms, offering researchers flexibility in their experimental designs. It has been extensively studied in the field of Life Sciences due to its ability to neutralize the effects of Pleiotrophin, thereby modulating cellular functions.
ALDH1A2 antibody
The ALDH1A2 antibody is a highly specialized product in the field of Life Sciences and Antibodies. It is specifically designed to target and interact with ALDH1A2, a growth factor that plays a crucial role in various biological processes. This antibody has been extensively tested and validated for its effectiveness in detecting and quantifying ALDH1A2 levels.
XRCC4 antibody
The XRCC4 antibody is a monoclonal antibody used in Life Sciences research. It specifically targets the XRCC4 protein, which plays a crucial role in DNA repair and recombination. The antibody binds to the histidine-tagged XRCC4 protein, allowing for its detection and analysis in various experimental settings. This XRCC4 antibody is commonly used in studies involving pluripotent cells, collagen synthesis, lipoprotein lipase regulation, and immune response modulation. Additionally, it has been shown to interact with other proteins such as interferon, TGF-beta, and endothelial growth factors. The XRCC4 antibody offers researchers a valuable tool for investigating DNA repair mechanisms and understanding their implications in various biological processes.
LGALS14 antibody
LGALS14 antibody was raised using the N terminal of LGALS14 corresponding to a region with amino acids MSSLPVPYTLPVSLPVGSCVIITGTPILTFVKDPQLEVNFYTGMDEDSDI
Histone H2Ax antibody
The Histone H2Ax antibody is a highly specialized monoclonal antibody used in Life Sciences research. This antibody specifically targets and binds to the acidic histone protein H2Ax, which plays a crucial role in DNA repair and damage response. By detecting the presence of H2Ax, researchers can gain valuable insights into various cellular processes, including fibrinogen activation, growth factor signaling, and multidrug resistance.
Thyroid Peroxidase antibody
Thyroid Peroxidase antibody is a monoclonal antibody used in Life Sciences research. It targets the thyroid peroxidase enzyme, which plays a crucial role in thyroid hormone synthesis. This antibody can be used to study the regulation and function of thyroid peroxidase, as well as its involvement in autoimmune thyroid diseases. Additionally, Thyroid Peroxidase antibody has been shown to have growth factor-like activity and can activate various signaling pathways. It has also been found to be involved in the glycosylation of proteins, including fibrinogen. Furthermore, this antibody has potential diagnostic applications as it can detect autoantibodies against thyroid peroxidase, which are often present in patients with autoimmune thyroid disorders. Overall, Thyroid Peroxidase antibody is a valuable tool for researchers studying thyroid biology and related diseases.
GPR120 antibody
The GPR120 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It acts as a growth factor and has the ability to neutralize epidermal growth factor (EGF) and TGF-beta. This antibody is widely used in research laboratories and pharmaceutical companies for its inhibitory properties. It specifically targets GPR120, a receptor protein that plays a crucial role in fatty acid metabolism. The GPR120 antibody can be used to study the activation of this receptor and its downstream signaling pathways. Additionally, it has been proven effective in detecting c-myc expression and alpha-fetoprotein levels. With its high specificity and reliability, the GPR120 antibody is an essential tool for researchers working in various fields of study within Life Sciences.
ApoD antibody
The ApoD antibody is a monoclonal antibody that specifically targets tumor necrosis factor-alpha (TNF-α). It is produced by hybridoma cells and has been widely used in the field of Life Sciences for research purposes. This monoclonal antibody has shown to effectively neutralize TNF-α, which plays a crucial role in inflammation and immune response. In addition to TNF-α, the ApoD antibody also targets other cytokines such as interleukin-6 (IL-6) and leukemia inhibitory factor (LIF). The binding of this antibody to its target molecules can modulate various cellular processes including transmembrane conductance, epidermal growth factor signaling, and oncogenic kinase activity. With its high specificity and affinity, the ApoD antibody is a valuable tool for researchers studying these pathways and exploring potential therapeutic applications. Additionally, polyclonal antibodies against ApoD are also available for researchers who require a broader range of epitope recognition.
p53 antibody
The p53 antibody is a highly effective inhibitor used in Life Sciences research. This monoclonal antibody specifically targets and neutralizes the p53 protein, which plays a crucial role in regulating cell growth and preventing tumor formation. By blocking the activity of p53, this antibody can be used to study the molecular mechanisms involved in cell cycle control, DNA repair, and apoptosis. Additionally, it has been shown to enhance the cytotoxic effects of certain chemotherapeutic agents and interferon. With its high specificity and potency, the p53 antibody is a valuable tool for studying the function of this important tumor suppressor protein.
RAP1 antibody
The RAP1 antibody is a highly effective monoclonal antibody that specifically targets and neutralizes the activated form of RAP1. This antibody has been extensively tested and proven to be highly efficient in various applications such as lysis, immobilization, and electrode-based assays. It is widely used in Life Sciences research for its ability to inhibit interferon-induced cytotoxicity and promote endothelial growth. The RAP1 antibody is also known for its high affinity towards anti-dnp antibodies, making it an excellent tool for detecting and quantifying these specific antibodies in human serum samples. With its exceptional specificity and reliability, the RAP1 antibody is a valuable asset for any researcher or scientist working in the field of immunology or molecular biology.
VWF antibody (HRP)
VWF antibody (HRP) was raised in sheep using Rat vWF purified from plasma as the immunogen.
CD11b antibody (PE)
CD11b antibody (biotin) was raised in rat using peritoneal macrophages from C57 B1/6 x DBA/2 F1 hybrid mice as the immunogen.
Degré de pureté :Min. 95%Mouse IgG Purified
The purified Mouse IgG h+l can be utilized for ELISA, Western Blot and as a Blocking Agent. Please inquire for bulk pricing.
Degré de pureté :>95% By Sds-PageRNF19A antibody
RNF19A antibody was raised using the N terminal of RNF19A corresponding to a region with amino acids IFSTNTSSDNGLTSISKQIGDFIECPLCLLRHSKDRFPDIMTCHHRSCVD
Degré de pureté :Min. 95%PTGES antibody
PTGES antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.
Degré de pureté :Min. 95%HBsAg Mouse Monoclonal Antibody
Please enquire for more information about HBsAg Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page
Degré de pureté :Min. 95%Denosumab
CAS :Monoclonal antibody against RANKL; anti-resorptive agent for osteoperosis treatment
Degré de pureté :(Sec-Hplc) Min. 95 Area-%Couleur et forme :Clear LiquidDengue Virus Type 1 Envelope Antigen, Recombinant
Please enquire for more information about Dengue Virus Type 1 Envelope Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page
Degré de pureté :Min. 95%CA 125 antibody (biotin)
CA 125 antibody (biotin) was raised in mouse using affinity pure human CA 125 antigen as the immunogen.
