Anticorps primaires
Les anticorps primaires sont des immunoglobulines qui se lient spécifiquement à un antigène d'intérêt, permettant la détection et la quantification de protéines, peptides ou autres biomolécules. Ces anticorps sont des outils essentiels dans de nombreuses applications, notamment le Western blot, l'immunohistochimie et l'ELISA. Chez CymitQuimica, nous proposons une vaste sélection d'anticorps primaires de haute qualité, offrant spécificité et sensibilité pour divers besoins de recherche, notamment en cancérologie, immunologie et biologie cellulaire.
Sous-catégories appartenant à la catégorie "Anticorps primaires"
- Anticorps pour la recherche sur le cancer(3.620 produits)
- Anticorps cardio-vasculaires(2 produits)
- Biologie du développement(751 produits)
- Anticorps relatifs à l’épigénétique(162 produits)
- Anticorps d'immunologie(2.551 produits)
- Anticorps du métabolisme(279 produits)
- Anticorps de microbiologie(739 produits)
- Transduction du signal(2.717 produits)
- Tags & Marqueurs cellulaires(33 produits)
Affichez 1 plus de sous-catégories
75447 produits trouvés pour "Anticorps primaires"
Trier par
Degré de pureté (%)
0
100
|
0
|
50
|
90
|
95
|
100
Alpha-fetoprotein antibody
Alpha-fetoprotein antibody is a powerful tool used in Life Sciences research. It is an antibody that specifically targets and binds to alpha-fetoprotein (AFP), a protein found in human serum. This antibody has a wide range of applications, including antiviral research, adipose tissue studies, and cancer research.SOD1 antibody
The SOD1 antibody is a specific antibody that binds to superoxide dismutase 1 (SOD1), an enzyme involved in the breakdown of superoxide radicals. This antibody is used in Life Sciences research to study protein conformations and identify different forms of SOD1. It can be biotinylated for easy detection and visualization using techniques such as immunofluorescence or Western blotting. The SOD1 antibody is available in both polyclonal and monoclonal forms, with the monoclonal antibody derived from a hybridoma cell line. Researchers rely on these antibodies to accurately detect and quantify SOD1 levels in various biological samples, providing valuable insights into oxidative stress and related diseases.
DBI antibody
DBI antibody was raised using a synthetic peptide corresponding to a region with amino acids MSQAEFEKAAEEVRHLKTKPSDEEMLFIYGHYKQATVGDINTERPGMLDFS100 beta antibody
The S100 beta antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It is specifically designed to neutralize interferon and ifn-gamma, two important proteins involved in immune response regulation. This antibody is derived from a unique combination of excipients and globulins, ensuring its stability and effectiveness.BAT1 antibody
BAT1 antibody was raised using the C terminal of BAT1 corresponding to a region with amino acids YDMPEDSDTYLHRVARAGRFGTKGLAITFVSDENDAKILNDVQDRFEVNI
THC antibody
The THC antibody is a highly specialized detection method for delta-9-tetrahydrocannabinol (THC). It utilizes the polymerase chain reaction (PCR) technique to amplify and detect THC-specific DNA sequences. This antibody exhibits strong DNA binding activity, allowing for efficient detection of even trace amounts of THC in various samples. It has been extensively tested and validated in Life Sciences research, demonstrating its reliability and accuracy.HSL antibody
The HSL antibody is a highly effective monoclonal antibody that specifically targets alpha-synuclein, a protein associated with neurodegenerative diseases such as Parkinson's and Alzheimer's. This antibody has been shown to activate glucose transporters in cells, leading to increased energy metabolism and improved neuronal function. Additionally, the HSL antibody has cytotoxic properties against cancer cells expressing the CD20 antigen, making it a potential therapeutic option for certain types of lymphoma. This antibody also interacts with tyrosine kinases and mitogen-activated protein kinases, signaling pathways involved in cell growth and proliferation. With its high specificity and affinity, the HSL antibody is a valuable tool for researchers in the life sciences field studying protein localization, expression, and function.PECAM1 antibody
The PECAM1 antibody is a highly specialized antibody that targets the Platelet Endothelial Cell Adhesion Molecule-1 (PECAM1). It is commonly used in research and life sciences applications involving mesenchymal stem cells. This antibody comes in both polyclonal and monoclonal forms, offering researchers a wide range of options for their experiments.GPR171 antibody
The GPR171 antibody is a highly specialized polyclonal antibody that is designed to target and bind to the GPR171 receptor. This receptor is activated by progesterone, interferon, and growth hormone, making it an important target for research in the field of Life Sciences. The GPR171 antibody can be used in various applications such as immunoassays and neutralizing experiments. It is also compatible with aldehyde-based fixation methods, allowing for easy integration into existing research protocols. With its high specificity and affinity, this monoclonal antibody is an invaluable tool for scientists studying chemokine signaling pathways and steroid receptors.TRIM67 antibody
TRIM67 antibody was raised using the C terminal of TRIM67 corresponding to a region with amino acids GGVCKGATVGVLLDLNKHTLTFFINGQQQGPTAFSHVDGVFMPALSLNRNMER antibody
MER antibody was raised in Mouse using a purified recombinant fragment of MER expressed in E. coli as the immunogen.ARL6IP1 antibody
ARL6IP1 antibody was raised in rabbit using the C terminal of ARL6IP1 as the immunogenDOCK11 antibody
The DOCK11 antibody is a growth factor that plays a crucial role in various processes within the Life Sciences field. It is an essential component in cell antigen recognition and the production of antibodies. The DOCK11 antibody has been shown to inhibit the activity of protons, which are responsible for acidification and cellular damage. Additionally, it has been found to have inhibitory effects on interleukin-6, a cytokine involved in inflammation and immune response regulation.
LENG4 antibody
LENG4 antibody was raised using the C terminal Of Leng4 corresponding to a region with amino acids LSAYWHGLHPGYYLSFLTIPLCLAAEGRLESALRGRLSPGGQKAWDWVHW
Estrogen Receptor alpha antibody
The Estrogen Receptor alpha antibody is a highly specialized biomolecule used in the field of life sciences. It is a monoclonal antibody that specifically targets the estrogen receptor alpha, a nuclear receptor involved in various cellular processes. This antibody recognizes and binds to the antigen binding domain of the estrogen receptor alpha, allowing for precise detection and analysis.cMyc antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections, thanks to its bactericidal activity. This active compound works by inhibiting bacterial growth through binding to DNA-dependent RNA polymerase, preventing transcription and replication. Its efficacy has been demonstrated using a patch-clamp technique on human erythrocytes. The drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits their cell growth in culture.VDAC3 antibody
The VDAC3 antibody is a highly specialized molecule drug that plays a crucial role in various biological processes. It is commonly used in research and diagnostic applications to study the function and localization of the voltage-dependent anion channel 3 (VDAC3). This antibody has been extensively tested and validated for its specificity and sensitivity.
HOXB9 antibody
The HOXB9 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It is designed to specifically target and bind to the HOXB9 protein, which plays a crucial role in various cellular processes. This antibody is produced using state-of-the-art techniques and undergoes stringent quality control measures to ensure its efficacy and reliability.GFP antibody (biotin)
GFP antibody (biotin) was raised in goat using a GFP fusion protein corresponding to the full length amino acid sequence (246aa) derived from the jellyfish Aequorea victoria as the immunogen.
Cystatin B antibody
Cystatin B antibody was raised using a synthetic peptide corresponding to a region with amino acids MMCGAPSATQPATAETQHIADQVRSQLEEKENKKFPVFKAVSFKSQVVAGPOSTN antibody
The POSTN antibody is an inhibitory factor that belongs to the group of polyclonal antibodies. It is specifically designed to target and neutralize the activity of POSTN, a protein expressed in cardiomyocytes. This antibody is widely used in life sciences research and has been shown to effectively inhibit the function of autoantibodies against POSTN. The POSTN antibody is available in both polyclonal and monoclonal forms, allowing researchers to choose the most suitable option for their experiments. Its high affinity and specificity make it an ideal tool for studying the role of POSTN in various biological processes, such as cell signaling, inflammation, and tissue remodeling. The amino-terminal region of the POSTN protein is particularly targeted by this antibody, ensuring accurate and reliable results. Order your POSTN antibody today and unlock new insights into its function and therapeutic potential.
FGR antibody
The FGR antibody is a monoclonal antibody that specifically targets fibrinogen, a protein involved in blood clotting. This antibody has fluorescence-activated properties, making it ideal for use in various Life Sciences applications. It can be used to detect and quantify fibrinogen levels in samples such as platelet fibrinogen or nuclear extracts. The FGR antibody exhibits high affinity and specificity for its target, ensuring accurate and reliable results. Its DNA binding activity allows it to form antigen-antibody complexes, enabling the detection of fibrinogen in various assays. With its molecular weight complexes and histidine tag, this antibody offers versatility and ease of use. Whether you're studying coagulation disorders or investigating the role of fibrinogen in disease processes, the FGR antibody is a valuable tool for your research needs.SSX1 antibody
The SSX1 antibody is a monoclonal antibody that has a stimulatory effect on the beta3-adrenoceptor. It is used in hybridization studies to detect the presence of SSX1 mRNA in various tissues and cell lines. The SSX1 antibody has been shown to specifically bind to the proto-oncogene c-fos in nuclear extracts, forming a specific complex that can be detected using techniques such as immunohistochemistry or Western blotting. In addition, this antibody has been used in life sciences research to study the activated state of cells and its role in processes such as epithelial-mesenchymal transformation. The SSX1 antibody can also be used as a test substance to evaluate its effects on DNA binding activity or other cellular processes. Its efficacy has been demonstrated through various experimental techniques, including cresyl violet staining.Actin antibody
Actin antibody was raised in mouse using a synthetic N-terminus decapeptide of a smooth-muscle isoform of actin as the immunogen.SLC3A2 antibody
The SLC3A2 antibody is a highly specialized antibody that targets specific proteins in the body. It is known for its ability to detect autoantibodies and protein carbonyls, which are important indicators of certain health conditions. This antibody can be used in various applications, including immobilization on electrodes for ultrasensitive detection and studying the role of fibrinogen in reactive processes. Additionally, it has neutralizing properties that make it useful in Life Sciences research, particularly in the study of mesenchymal stem cells and their protein interactions. The SLC3A2 antibody is available as both monoclonal and polyclonal antibodies, ensuring high specificity and accuracy in experimental settings. With its colloidal properties, this antibody offers a reliable tool for scientists and researchers seeking to uncover new insights into protein function and disease mechanisms.FBXO8 antibody
FBXO8 antibody was raised using the middle region of FBXO8 corresponding to a region with amino acids EFFRHIHAPEERGEYLETLITKFSHRFCACNPDLMRELGLSPDAVYVLCYVimentin antibody
The Vimentin antibody is a highly effective monoclonal antibody that is used in the field of Life Sciences. It plays a crucial role in research related to amyloid plaque and other growth factors. This antibody specifically targets vimentin, a protein that is present in various cell types, including mesenchymal cells, fibroblasts, and endothelial cells. The Vimentin antibody can be used for various applications such as immunohistochemistry, immunofluorescence, and Western blotting.CPN60 antibody
The CPN60 antibody is a monoclonal antibody used in the field of Life Sciences. It specifically targets dimers and is commonly used as an anti-CD25 antibody drug. The CPN60 antibody has been shown to inhibit p38 MAPK, which plays a crucial role in cellular signaling pathways. Additionally, it has been found to interact with annexin, a protein involved in various cellular processes. This antibody also acts as an inhibitor of hydroxyl globulin activation and can be used in recombinant medicaments. The CPN60 antibody is supplied in a buffered solution and exhibits chemokine-like properties. With its high specificity and effectiveness, this monoclonal antibody is an essential tool for researchers in the field of Life Sciences.2'-PDE antibody
2'-PDE antibody was raised using the middle region of 2'-Pde corresponding to a region with amino acids CLDYIFIDLNALEVEQVIPLPSHEEVTTHQALPSVSHPSDHIALVCDLKWNT5M antibody
NT5M antibody was raised using the middle region of NT5M corresponding to a region with amino acids KYAWVEKYFGPDFLEQIVLTRDKTVVSADLLIDDRPDITGAEPTPSWEHVMESP1 antibody
MESP1 antibody was raised in Mouse using a purified recombinant fragment of human MESP1 expressed in E. coli as the immunogen.SERPINB2 antibody
The SERPINB2 antibody is a highly specialized monoclonal antibody that has multiple characteristics and applications. It acts as an anti-VEGF (vascular endothelial growth factor) agent, neutralizing the effects of this growth factor. Additionally, it targets caspase-9, a key enzyme involved in apoptosis, making it useful for research and therapeutic purposes.NGRN antibody
NGRN antibody was raised using the N terminal of NGRN corresponding to a region with amino acids MAVTLSLLLGGRVCAAVTRCGFATRGVAGPGPIGREPDPDSDWEPEERELCalmodulin antibody
Calmodulin antibody was raised in mouse using a synthethic peptide corresponding to the 21 carboxy-terminal amino acids of bovine calmodulin, conjugated with tyroglobulin, as the immunogen.FKBP38 antibody
The FKBP38 antibody is a highly specialized monoclonal antibody that targets and neutralizes FKBP38, a protein involved in nephrotoxicity. This antibody specifically binds to FKBP38 and prevents its interaction with collagen, thereby reducing the harmful effects of nephrotoxicity. In addition, the FKBP38 antibody has been shown to inhibit the growth factor activity of FKBP38, further enhancing its therapeutic potential. With its high specificity and effectiveness, this antibody is a valuable tool for researchers in the Life Sciences field studying nephrotoxicity and related biomolecules.FALZ antibody
FALZ antibody was raised in mouse using recombinant Human Bromodomain Phd Finger Transcription Factor (Bptf)cIAP1 antibody
The cIAP1 antibody is a highly specialized antibody used in Life Sciences research. It is designed to specifically target and bind to cellular inhibitor of apoptosis protein 1 (cIAP1). This antibody has been extensively tested and validated for its effectiveness in various applications.GOLGA7 antibody
GOLGA7 antibody was raised using the middle region of GOLGA7 corresponding to a region with amino acids ACLTAYTIFLCMETHYEKVLKKVSKYIQEQNEKIYAPQGLLLTDPIERGLCLIC5 antibody
CLIC5 antibody was raised using the C terminal of CLIC5 corresponding to a region with amino acids YRNYDIPAEMTGLWRYLKNAYARDEFTNTCAADSEIELAYADVAKRLSRSRPA2 antibody
The RPA2 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It is specifically designed to neutralize endothelial growth factors, which play a crucial role in various physiological processes. This antibody targets chemokine and basic proteins that are involved in angiogenesis and cell migration. By binding to these proteins, the RPA2 antibody effectively inhibits their activity, thereby reducing the viscosity of intraocular fluid and preventing abnormal blood vessel formation.
