Anticorps primaires

Rabbit polyclonal TSPAN13 antibody

Mouse monoclonal anti human C1QBP antibody

The PNMT antibody is an extracellular antigen that plays a crucial role in reductive processes. It can be used in various applications, including adeno-associated virus research and the development of therapeutic antibodies. The PNMT antibody is a highly specific monoclonal antibody that targets the activated form of the PNMT protein complex. It has been extensively tested and shown to have neutralizing properties against multidrug-resistant strains. This antibody is widely used in the life sciences field for its ability to detect and study low-density protein complexes. With its high specificity and soluble nature, the PNMT antibody is an invaluable tool for researchers in need of reliable and accurate detection methods.

MEST antibody was raised in Rabbit using Human MEST as the immunogen

Affinity purified Rabbit polyclonal HLADMB antibody

The RhoA antibody is a powerful tool in the field of Life Sciences. It is a highly specific antibody that targets RhoA, a small GTPase protein involved in various cellular processes. This antibody can be used in both research and clinical settings to study the role of RhoA in different biological pathways.

Rabbit polyclonal UBE2E2 antibody

Rabbit polyclonal GRIN2C antibody

Rabbit polyclonal VOPP1 antibody

Affinity purified Rabbit polyclonal MBNL3 antibody

CGRP antibody was raised in guinea pig using synthetic human calcitonin gene related peptide as the immunogen.

Rabbit polyclonal PKLR antibody

Affinity purified Rabbit polyclonal FGF22 antibody

The NOTCH3 antibody is a powerful tool in the field of Life Sciences. It specifically targets and binds to the activated form of NOTCH3, a growth factor involved in various cellular processes. This antibody is available in both polyclonal and monoclonal forms, providing researchers with options to suit their specific needs.

Rabbit polyclonal CD336 antibody

Rabbit polyclonal TRPS1 antibody

The Tie2 antibody is a highly specialized monoclonal antibody that targets the carboxyl terminus of the Tie2 receptor. It is commonly used in Life Sciences research to study the role of Tie2 in various biological processes. This antibody specifically binds to human hepatocytes and has been shown to inhibit elastase activity, which is crucial for maintaining tissue integrity. The Tie2 antibody is produced using state-of-the-art hybridization techniques and purified using bovine γ-globulin and streptavidin. Its high specificity and low viscosity make it an ideal tool for studying the natriuretic properties of Tie2 and its potential therapeutic applications.

Purified Polyclonal MCT8 antibody

Rabbit polyclonal Clofibrate antibody

GFM2 antibody was raised in Rabbit using Human GFM2 as the immunogen

The RPA2 antibody is a highly specialized monoclonal antibody that has been extensively studied for its therapeutic potential in various conditions. It specifically targets calmodulin, a protein involved in many cellular processes. The RPA2 antibody has shown promising results in the treatment of heparin-induced thrombocytopenia, a condition characterized by low platelet count due to an immune reaction to heparin.

Affinity purified Rabbit polyclonal IKK beta antibody

Rabbit polyclonal Cytochrome P450 2R1 antibody

Rabbit polyclonal AQP2 antibody (Ser269)

Rabbit polyclonal PPIA antibody (FITC)

The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug from the class of rifamycins. It is specifically designed to target tuberculosis infections and contains active compounds that exhibit strong bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, preventing transcription and replication, thus inhibiting bacterial growth. The effectiveness of this drug has been demonstrated through extensive research using advanced techniques such as the patch-clamp technique on human erythrocytes. Moreover, it undergoes various metabolic transformations including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it binds to specific markers expressed at high levels in Mycobacterium tuberculosis strains, inhibiting cell growth in culture.

Rabbit polyclonal Actin gamma 2 antibody

The SPO11 antibody is a highly specialized protein that plays a crucial role in the process of DNA recombination during meiosis. It specifically targets and binds to the SPO11 protein, which is responsible for initiating the formation of double-strand breaks in DNA. This antibody has been extensively studied in the field of life sciences and is widely used as a research tool in various applications.

Transglutaminase 2 antibody is a highly specialized monoclonal antibody that targets the transglutaminase 2 protein. This protein plays a crucial role in various cellular processes, including apoptosis, cell adhesion, and signal transduction. The antibody specifically recognizes and binds to transglutaminase 2, inhibiting its enzymatic activity.

The West Nile virus antibody is a monoclonal antibody used in Life Sciences. It binds to specific proteins and inhibits the growth factor GM-CSF, which is involved in the production of white blood cells. This antibody can be used as a research tool for studying the effects of GM-CSF inhibitors on cell growth and differentiation. Additionally, it has been shown to interact with other antibodies, such as transferrin and actin filaments, further expanding its potential applications in various experimental settings. With its ability to modulate colony-stimulating factors and impact cell function, this antibody offers promising opportunities for scientific advancements in the field of immunology and beyond.

Rabbit polyclonal ARL2 antibody (FITC)

LRRC24 antibody was raised using the N terminal of LRRC24 corresponding to a region with amino acids HLPRLQELHLQENSIELLEDQALAGLSSLALLDLSRNQLGTISREALQPL

GLUD1 antibody was raised in Rabbit using Human GLUD1 as the immunogen

CD18 antibody was raised in Mouse using a purified recombinant fragment of CD18 expressed in E. coli as the immunogen.

The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug from the class of rifamycins. It is highly effective in treating tuberculosis infections and contains active compounds that exhibit bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, preventing transcription and replication, thus inhibiting bacterial growth. Its efficacy has been demonstrated through extensive research using the patch-clamp technique on human erythrocytes. The drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits cell growth in culture.

The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is specifically designed to treat tuberculosis infections by targeting active compounds and exhibiting bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, inhibiting transcription and replication in bacteria. Extensive research has shown its effectiveness through the patch-clamp technique on human erythrocytes. Metabolically, it undergoes hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it binds to specific markers expressed in Mycobacterium tuberculosis strains and effectively inhibits their growth in culture.

The STAT5A antibody is a polyclonal antibody that is used in Life Sciences research. It specifically targets e-cadherin, a protein involved in cell adhesion and signaling. This antibody recognizes the tyrosine-phosphorylated form of STAT5A, which is important for its activation and transcriptional activity. The STAT5A antibody can be used to study the role of e-cadherin in various cellular processes, such as cell proliferation, differentiation, and migration. Additionally, this antibody has been shown to have potential therapeutic applications in cancer treatment due to its ability to inhibit the growth factor signaling pathway mediated by e-cadherin.

Rabbit polyclonal NUDT19 antibody

The Cathepsin D antibody is a highly sensitive detection tool commonly used in immunoassays within the Life Sciences industry. This antibody is designed to specifically target and bind to Cathepsin D, an enzyme involved in various cellular processes. Its ultrasensitive detection capabilities make it ideal for research and diagnostic applications.

The EEF2 antibody is a highly specific monoclonal antibody that is widely used in life sciences research. It binds to and detects the eukaryotic elongation factor 2 (EEF2) protein, which plays a crucial role in protein synthesis. This antibody has been extensively validated for various applications, including immunohistochemistry, western blotting, and flow cytometry.

MYL3 antibody was raised in Mouse using a purified recombinant fragment of MYL3 expressed in E. coli as the immunogen.

Rabbit polyclonal PPP1R1B antibody (Thr75)

Affinity purified Rabbit polyclonal EPH receptor A8 antibody

The SPTLC1 antibody is a highly specialized polyclonal antibody that plays a crucial role in various life science applications. It is designed to target and bind to the SPTLC1 protein, which is involved in the synthesis of sphingolipids, an essential component of cell membranes.

Affinity purified Rabbit polyclonal NDUFA5 antibody

The TFF1 antibody is a highly specific monoclonal antibody that targets the glutamate receptor. It has cytotoxic properties and can effectively neutralize autoantibodies in the body. The TFF1 antibody is designed to specifically bind to reactive antibodies, preventing them from causing harm to healthy cells. Additionally, this antibody has been shown to inhibit the activity of β-catenin, a protein involved in cell adhesion and signaling pathways.

Rabbit polyclonal STON1 antibody

The alpha Tubulin antibody is a highly specialized diagnostic agent used in the field of Life Sciences. It belongs to the class of Polyclonal Antibodies and is specifically designed to target and bind to alpha tubulin, a protein that plays a crucial role in cell division and intracellular transport. This antibody has been extensively tested and validated for its genotoxic activity, making it an essential tool for researchers studying various cellular processes.

PIB5PA antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.

Mouse monoclonal MVK antibody

Mouse monoclonal Cytokeratin 4+5+6+8+10+13+18 antibody (FITC)

Protein kinase B (also known as RAC-alpha serine/threonine-protein kinase: Atk) is a serum and glucocorticoid-regulated protein kinase with three highly homologous isoforms (Akt1, 2 and 3). Akt1 and Akt3 are the predominant isoforms expressed in the brain, whereas Akt2 is mainly expressed in skeletal muscle and embryonic brown fat. These proteins play major regulatory roles in a range of physiological processes including: growth, proliferation, cell survival, angiogenesis, metabolism and Akt is also considered a proto-oncogene.Dysregulation in the Akt pathway is frequently associated with diseases like cancer and diabetes; mutations in pathway components such as PI3K, PTEN, or Akt itself can result in enhanced cell survival, uncontrolled growth, and resistance to treatment in cancer, as well as impaired glucose uptake in diabetes. Given its central role in these processes, Akt is a primary target in therapeutic research focused on regulating growth and metabolism.

The GPR1 antibody is a monoclonal antibody that specifically targets the epidermal growth factor receptor (EGFR). It belongs to the family of EGFR-like antibodies and has been shown to have neutralizing effects on the activity of EGFR. This antibody can be used in various research applications, including immunohistochemistry and Western blotting, to study the role of EGFR in cell signaling pathways. Additionally, the GPR1 antibody has been used to investigate the interactions between EGFR and other molecules, such as fibronectin and chemokines. Its high specificity and affinity make it a valuable tool for researchers in the field of life sciences studying growth factors and their associated signaling pathways.

Rabbit polyclonal ZFYVE16 antibody

Affinity purified Rabbit polyclonal BRE antibody

CD19 antibody was raised in Mouse using a purified recombinant fragment of human CD19 expressed in E. coli as the immunogen.

PTGES antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.

The VAPA antibody is a neutralizing anti-CD33 antibody that is widely used in the field of Life Sciences. It is commonly employed in immunohistochemistry studies to detect and analyze the expression of CD33, a cell surface protein involved in various cellular processes. This antibody specifically targets and binds to CD33, blocking its activity and preventing its interaction with other molecules.

IFNAR2 antibody was raised in mouse using human interferon alpha/beta receptor chain 1 as the immunogen.

GJB1 antibody was raised using the C terminal of GJB1 corresponding to a region with amino acids GFGHRLSPEYKQNEINKLLSEQDGSLKDILRRSPGTGAGLAEKSDRCSAC

Mouse monoclonal Episialin antibody

Transferrin antibody is a monoclonal antibody that specifically targets and neutralizes transferrin, a protein complex involved in the transport of iron in the body. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in various applications. It has the ability to bind to transferrin with high affinity, preventing its interaction with receptors and inhibiting iron uptake by cells. This can be particularly useful in conditions where excessive iron accumulation is detrimental, such as certain types of cancer or neurodegenerative diseases. Additionally, transferrin antibody has been explored for its potential use in diagnostic assays, as it can detect and quantify transferrin levels in biological samples. Its unique properties make it a valuable tool for researchers working on understanding the role of transferrin and its associated pathways in health and disease.

GOT1 antibody was raised in Rabbit using Human GOT1 as the immunogen

EXOSC3 antibody was raised using the C terminal of EXOSC3 corresponding to a region with amino acids PLEIVFGMNGRIWVKAKTIQQTLILANILEACEHMTSDQRKQIFSRLAES

The SLUG antibody is a monoclonal antibody that specifically targets a molecule called SLUG. It has cytotoxic properties, meaning it can kill cells that express SLUG. This antibody has been extensively studied and shown to be effective in various applications.

LPXN antibody was raised in Rabbit using Human LPXN as the immunogen

E2F6 antibody was raised in Rabbit using Human E2F6 as the immunogen

Rat monoclonal CD19 antibody (FITC)

Mouse monoclonal RNPEP antibody

Rabbit polyclonal LDHA antibody (biotin)

DLG3 antibody was raised in Rabbit using Human DLG3 as the immunogen

ACP2 antibody was raised in Rabbit using Human ACP2 as the immunogen

The ENO2 antibody is a highly specialized product that plays a crucial role in various areas of life sciences. This polyclonal antibody is specifically designed to target and detect autoantibodies associated with microvessel density. It utilizes particle chemiluminescence technology, allowing for accurate and efficient detection.

Rabbit polyclonal CLCN6 antibody

IL10 antibody is a medicament that belongs to the class of antibodies. It is a protein complex that specifically targets and binds to IL10, a cytokine involved in immune regulation. IL10 antibody can be used as a therapeutic agent for various diseases characterized by excessive IL10 activity, such as autoimmune disorders and inflammatory conditions. This monoclonal antibody has been extensively studied in the field of Life Sciences and has shown promising results in preclinical and clinical trials. It has the ability to neutralize the effects of IL10, thereby reducing its immunosuppressive and anti-inflammatory properties. IL10 antibody is also being investigated for its potential antiviral activity and its ability to enhance the effectiveness of multidrug therapies.

ZNF364 antibody was raised using the C terminal Of Znf364 corresponding to a region with amino acids PWLELHDTCPVCRKSLNGEDSTRQSQSTEASASNRFSNDSQLHDRWTF

ALDOC antibody was raised using the C terminal of ALDOC corresponding to a region with amino acids CPLPRPWALTFSYGRALQASALNAWRGQRDNAGAATEEFIKRAEVNGLAA

The GPR4 antibody is a retinoid and HDAC inhibitor that belongs to the class of monoclonal antibodies. It is used in vaccine strains and has been shown to target β-catenin, collagen, and methyl transferase. This antibody is widely used in the field of life sciences and medicine for its nuclear properties. The GPR4 antibody specifically binds to Gynura procumbens and can be used as a tool for studying various cellular processes. With its high specificity and affinity, this antibody is a valuable tool for researchers in the field of antibodies.

The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections due to its bactericidal activity. This active compound works by binding to DNA-dependent RNA polymerase, which inhibits bacterial growth and prevents transcription and replication. Its potency has been demonstrated through various scientific techniques such as the patch-clamp technique on human erythrocytes. Metabolically, it undergoes hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed in Mycobacterium tuberculosis strains and inhibits their cell growth in culture.

Monoclonal antibody against RANKL; anti-resorptive agent for osteoperosis treatment

Please enquire for more information about Dengue Virus Type 1 Envelope Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page

Please enquire for more information about HBsAg Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page

CA 125 antibody (biotin) was raised in mouse using affinity pure human CA 125 antigen as the immunogen.

Cortisol antibody was raised in mouse using cortisol-3 BSA as the immunogen.