Anticorps primaires

Haptoglobin antibody was raised in goat using purified human haptoglobin as the immunogen.

Goat anti Human IgA is a secondary antibody that specifically binds to human IgA. It is commonly used in life sciences research and diagnostic applications. This antibody plays a crucial role in detecting and quantifying IgA levels in various biological samples.

CD79b antibody (Azide free) was raised in hamster using the beta chain of the murine B-cell receptor as the immunogen.

CD8a antibody (PE) was raised in mouse using porcine CD8a as the immunogen.

CD45 antibody (biotin) was raised in Rat using CD45/LCA as the immunogen.

Mouse anti-human IgG (Poly-HRP) was raised in mouse using human IgG as the immunogen.

Influenza A antibody was raised in mouse using Influenza A from A/Texas strain as the immunogen.

The Plasminogen antibody is a growth factor that plays a crucial role in various biological processes. It contains acid residues that enable it to bind to fibrinogen and exert its proteolytic activity. This Polyclonal Antibody can specifically recognize and bind to the Plasminogen antigen, leading to the formation of antigen-antibody complexes. These complexes have been shown to have various biological effects, including the regulation of hepatocyte growth and the modulation of microvessel density.

CD45R antibody (Spectral Red) was raised in rat using abelson murine leukemia virus-induced pre-B tumor cells as the immunogen.

CD90 antibody (FITC) was raised in rat using murine T-Cell hybridoma c6/G8, produced by fusion of porl insulin-specific BALB/c T cells with the AKR thymoma line BW 5147 as the immunogen.

CD25 antibody (PE) was raised in rat using IL-2-dependent BALB/c mouse helper T-cell clone HT-2 as the immunogen.

CD56 antibody (PE) was raised in mouse using human CD56 as the immunogen.

CD44 antibody (PE) was raised in rat using murine CD44 as the immunogen.

CD30 antibody (FITC) was raised in hamster using recombinant murine CD30 extracellular domain-mouse IgG1 fusion protein as the immunogen.

CD11b antibody (FITC) was raised in rat using peritoneal macrophages from C57 B1/6 x DBA/2 F1 hybrid mice as the immunogen.

CD90.2 antibody (biotin) was raised in rat using CD90.2/`Thy-1.2 alloantigen as the immunogen.

CD56 antibody (biotin) was raised in mouse using human CD56 as the immunogen.

The CD133 antibody is a highly specialized monoclonal antibody that has been activated to target specific glycan structures on the surface of cells. It has been extensively studied in the field of Life Sciences and has shown promising results in various applications. This antibody is capable of neutralizing chemokine receptors such as CXCR4 and can also inhibit the activity of colony-stimulating factors like GM-CSF and interleukin-6. The CD133 antibody is widely used in research laboratories for its ability to specifically bind to CD133-expressing cells, allowing for their identification and isolation. It is also commonly used in diagnostic assays and therapeutic development. For those seeking high-quality antibodies, the CD133 antibody is a reliable choice that offers exceptional specificity and sensitivity.

UBTD1 antibody was raised in rabbit using the middle region of UBTD1 as the immunogen

TMEM63A antibody was raised using the N terminal of TMEM63A corresponding to a region with amino acids MDSPFLELWQSKAVSIREQLGLGDRPNDSYCYNSAKNSTVLQGVTFGGIP

SPINK6 antibody was raised in rabbit using the middle region of SPINK6 as the immunogen