Anticorps primaires
Les anticorps primaires sont des immunoglobulines qui se lient spécifiquement à un antigène d'intérêt, permettant la détection et la quantification de protéines, peptides ou autres biomolécules. Ces anticorps sont des outils essentiels dans de nombreuses applications, notamment le Western blot, l'immunohistochimie et l'ELISA. Chez CymitQuimica, nous proposons une vaste sélection d'anticorps primaires de haute qualité, offrant spécificité et sensibilité pour divers besoins de recherche, notamment en cancérologie, immunologie et biologie cellulaire.
Sous-catégories appartenant à la catégorie "Anticorps primaires"
- Anticorps pour la recherche sur le cancer(3.721 produits)
- Anticorps cardio-vasculaires(2 produits)
- Biologie du développement(764 produits)
- Anticorps relatifs à l’épigénétique(162 produits)
- Anticorps d'immunologie(2.585 produits)
- Anticorps du métabolisme(286 produits)
- Anticorps de microbiologie(741 produits)
- Transduction du signal(2.765 produits)
- Tags & Marqueurs cellulaires(34 produits)
Affichez 1 plus de sous-catégories
75562 produits trouvés pour "Anticorps primaires"
Trier par
Degré de pureté (%)
0
100
|
0
|
50
|
90
|
95
|
100
PCNP antibody
The PCNP antibody is a powerful tool in the field of Life Sciences. It is a steroid antibody that specifically targets and binds to PCNP (Proliferating Cell Nuclear Antigen) protein. This polyclonal antibody has been extensively tested and validated for use in various immunoassays, making it an essential component in research related to antibodies and their interactions with PCNP.
LOC284009 antibody
LOC284009 antibody was raised using the N terminal of LOC284009 corresponding to a region with amino acids IRCGRPAVVHIGGEGARWEKGARGRKEHRLRRSDLGSRPVPFLAQGIPDICDKL1 antibody
The CDKL1 antibody is a powerful tool used in Life Sciences research. It is a polyclonal antibody that has been specifically designed to target the CDKL1 protein. This antibody can be used in various applications such as immunoassays, polymerase chain reaction assays, and neutralizing assays.Progesterone Receptor antibody
The Progesterone Receptor antibody is a powerful tool used in Life Sciences research. This monoclonal antibody specifically targets the progesterone receptor, a protein involved in various cellular processes. It can be used to study the role of progesterone signaling in development, reproduction, and cancer.α 2 Antiplasmin antibody
Alpha 2 antiplasmin antibody was raised in mouse using purified alpha-2 antiplasmin as the immunogen.CDC23 antibody
CDC23 antibody was raised using a synthetic peptide corresponding to a region with amino acids RAAHFLHGCNSKKAYFLYMYSRYLSGEKKKDDETVDSLGPLEKGQVKNEAGPR161 antibody
GPR161 antibody was raised using the N terminal of GPR161 corresponding to a region with amino acids MSLNSSLSCRKELSNLTEEEGGEGGVIITQFIAIIVITIFVCLGNLVIVVSTK38L antibody
STK38L antibody was raised using the middle region of STK38L corresponding to a region with amino acids PAAIPIEIKSIDDTSNFDDFPESDILQPVPNTTEPDYKSKDWVFLNYTYKDEDD antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the category of rifamycins. It is known for its exceptional efficacy in treating tuberculosis infections. This active compound exhibits bactericidal activity by binding to DNA-dependent RNA polymerase, which hinders transcription and replication processes. Extensive research has shown its high affinity towards human erythrocytes using the patch-clamp technique. Metabolically, it undergoes various transformations including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, this drug specifically targets markers expressed in Mycobacterium tuberculosis strains and inhibits their growth in culture.
UXT antibody
UXT antibody was raised using the N terminal of UXT corresponding to a region with amino acids MATPPKRRAVEATGEKVLRYETFISDVLQRDLRKVLDHRDKVYEQLAKYLMKK4 antibody
The MKK4 antibody is a highly specific monoclonal antibody that is widely used in the field of Life Sciences. It has been extensively studied and proven to be effective in various research applications. The antibody is designed to target and bind to MKK4, a protein involved in signal transduction pathways.Progesterone Receptor Antibody
The Progesterone Receptor Antibody is a highly reactive monoclonal antibody that specifically targets the progesterone receptor. It can be used for various applications, including research and diagnostic purposes. The antibody binds to the progesterone receptor with high affinity, allowing for accurate detection and quantification of the receptor in samples.G6PD antibody
G6PD antibody was raised using the middle region of G6PD corresponding to a region with amino acids VTKNIHESCMSQIGWNRIIVEKPFGRDLQSSDRLSNHISSLFREDQIYRIATP6V1B1 antibody
The ATP6V1B1 antibody is a glycopeptide that acts as an anti-connexin agent. It belongs to the group of polyclonal antibodies and has colloidal properties. This antibody is capable of neutralizing estrogen receptors and hormone peptides, making it useful in various applications within the field of Life Sciences. Additionally, the ATP6V1B1 antibody has neuroprotective properties and plays a role in glycan and glycosylation processes. It is important to note that this antibody should be handled with care, as it may have teratogenic effects. With its high specificity and effectiveness, the ATP6V1B1 antibody is an invaluable tool for researchers and scientists working in the field of peptide agents. Both its monoclonal and polyclonal forms are available, providing flexibility for different experimental needs.CD326 antibody
The CD326 antibody is a monoclonal antibody that specifically targets the epidermal growth factor protein. It is commonly used in Life Sciences research to study the role of this protein in various cellular processes. This antibody can be used for applications such as Western blotting, immunohistochemistry, and flow cytometry.
ApoH antibody
ApoH antibody was raised using a synthetic peptide corresponding to a region with amino acids PPPSIPTFATLRVYKPSAGNNSLYRDTAVFECLPQHAMFGNDTITCTTHGClostridium difficile Toxin A antibody
Clostridium difficile Toxin A antibody is an active agent that specifically targets Clostridium difficile, a bacterium responsible for causing severe gastrointestinal infections. This antibody has a high affinity for the toxin produced by the bacteria and can effectively neutralize its harmful effects. The low density of this antibody allows for easy penetration into infected cells, where it can bind to and inhibit the activity of the toxin.JIP3 antibody
The JIP3 antibody is a highly effective and versatile tool used in various assays and research studies in the field of Life Sciences. This antibody specifically targets chloride, anti-mesothelin, telomerase, and other glycoproteins, making it an essential component for the detection and analysis of these markers. With its high-flux binding capabilities, this antibody ensures accurate and reliable results in serum marker analysis.DNA PKcs antibody
The DNA PKcs antibody is a highly specialized polyclonal antibody that targets the DNA-dependent protein kinase catalytic subunit (DNA PKcs). It is commonly used in research and laboratory settings to study various cellular processes involving DNA repair, recombination, and transcription. This antibody specifically recognizes and binds to the DNA PKcs protein, allowing researchers to investigate its role in different biological pathways.VARS antibody
VARS antibody was raised using the middle region of VARS corresponding to a region with amino acids AQRLRERRAASGYPVKVPLEVQEADEAKLQQTEAELRKVDEAIALFQKMLCHK1 antibody
The CHK1 antibody is a specific antibody that targets the checkpoint kinase 1 (CHK1) protein. It has been extensively used in life sciences research to study various cellular processes and signaling pathways. The CHK1 protein plays a crucial role in cell cycle regulation, DNA damage response, and cell survival. By inhibiting CHK1, this antibody can help researchers gain insights into the mechanisms of cancer development and identify potential therapeutic targets.
SUMO1 antibody
The SUMO1 antibody is a glycoprotein that belongs to the class of lectins. It is a monoclonal antibody that specifically targets SUMO1, a small ubiquitin-like modifier protein. This antibody has been extensively used in research and diagnostics in the field of Life Sciences. The SUMO1 antibody has high specificity and affinity for its target, making it an ideal tool for studying the function and regulation of SUMOylation. It can be used in various applications such as immunohistochemistry, western blotting, and flow cytometry. Additionally, this antibody has been shown to inhibit protease activity associated with SUMOylation, making it a valuable tool for investigating the role of SUMOylation in cellular processes. With its unique properties and wide range of applications, the SUMO1 antibody is an essential tool for researchers in the field of protein kinase inhibitors and autoantibodies.
ST3GAL5 antibody
ST3GAL5 antibody was raised using the N terminal of ST3GAL5 corresponding to a region with amino acids DSEAESKYDPPFGFRKFSSKVQTLLELLPEHDLPEHLKAKTCRRCVVIGS
C2orf30 antibody
C2orf30 antibody was raised using the middle region of C2orf30 corresponding to a region with amino acids GKHVHQYHEDKDSGKTSVVVGTWNQEEHIEWAKKNTARAYHLQDDGTQTVCLIC1 antibody
CLIC1 antibody was raised using the C terminal of CLIC1 corresponding to a region with amino acids LTLADCNLLPKLHIVQVVCKKYRGFTIPEAFRGVHRYLSNAYAREEFASTLCK antibody
The LCK antibody is a monoclonal antibody that targets LCK, a protein involved in T cell signaling. This antibody is commonly used in Life Sciences research to study immune responses and investigate the role of LCK in various cellular processes. It has been shown to be effective in blocking LCK activity, leading to decreased T cell activation and cytotoxicity. Additionally, the LCK antibody has potential therapeutic applications as it can be used to develop immunogenic compositions for the treatment of viral infections or autoimmune diseases. Its high specificity and affinity make it a valuable tool for scientists working in the field of immunology and drug discovery.Helicobacter pylori antibody
Helicobacter pylori antibody is a monoclonal antibody used in the field of Life Sciences. It is colloidal in nature and specifically targets Helicobacter, a bacterium known to cause various gastrointestinal disorders. This antibody has also been found to have anti-VEGF (vascular endothelial growth factor) properties, making it potentially useful in antiangiogenic therapies. Additionally, it has shown promising results in combination with sorafenib, a drug used in the treatment of certain types of cancer. The microsphere formulation of this antibody allows for targeted delivery and enhanced efficacy. Furthermore, studies have indicated its potential role in regulating erythropoietin levels and modulating brain natriuretic peptide and calmodulin signaling pathways. With its multifaceted properties, this monoclonal antibody holds great promise for advancements in the field of medical research and therapeutics.MRTO4 antibody
MRTO4 antibody was raised using a synthetic peptide corresponding to a region with amino acids SKLKDIRNAWKHSRMFFGKNKVMMVALGRSPSDEYKDNLHQVSKRLRGEVGTPBP9 antibody
GTPBP9 antibody was raised using a synthetic peptide corresponding to a region with amino acids GLPNVGKSTFFNVLTNSQASAENFPFCTIDPNESRVPVPDERFDFLCQYHCDH2 antibody
The CDH2 antibody is a monoclonal antibody that targets the CDH2 protein expressed in various tissues, including rat liver microsomes. This antibody is widely used in Life Sciences research to study the role of CDH2 in different biological processes. It has been shown to have cholinergic and catecholaminergic properties, affecting neurotransmitter release and signaling pathways. Additionally, the CDH2 antibody has been found to modulate the expression of interleukin-6 and dopamine in rat liver microsomes. Its binding to the CDH2 protein leads to lysis of target cells and inhibition of cellular functions. Researchers also utilize this antibody to detect the presence of CDH2 in samples using techniques like immunofluorescence or Western blotting. The CDH2 antibody is available as both monoclonal and polyclonal antibodies, providing researchers with options for their specific experimental needs.Apolipoprotein E antibody
The Apolipoprotein E antibody is a polyclonal antibody that specifically targets the colony-stimulating factor (CSF) Apolipoprotein E. This antibody has been shown to have neutralizing effects on the toxic effects of CSF, making it a valuable tool for research in the field of immunology. It has also been shown to inhibit the activity of alpha-fetoprotein and family kinase inhibitor, further highlighting its versatility in various applications. The Apolipoprotein E antibody can be used in immunoassays such as ELISA or Western blotting to detect and quantify the presence of this protein in biological samples. With its high specificity and affinity, this monoclonal antibody is an essential tool for researchers studying the role of Apolipoprotein E in various physiological processes.PR6 antibody
The PR6 antibody is a highly specialized monoclonal antibody with unique characteristics. It has been extensively studied for its hybridization capabilities and its ability to bind to the amino-terminal region of specific proteins. This antibody exhibits high viscosity, making it ideal for use in assays that require increased sensitivity.Neuropilin 1 antibody
The Neuropilin 1 antibody is a highly specialized antibody used in the field of Life Sciences. It is designed to specifically target and bind to the neuropilin 1 molecule, which plays a crucial role in various biological processes. This antibody is available in both polyclonal and monoclonal forms, providing researchers with options for their specific experimental needs.CSTF2 antibody
CSTF2 antibody was raised using the N terminal of CSTF2 corresponding to a region with amino acids VDPEIALKILHRQTNIPTLIAGNPQPVHGAGPGSGSNVSMNQQNPQAPQAKLHL12 antibody
KLHL12 antibody was raised in Mouse using a purified recombinant fragment of human KLHL12 expressed in E. coli as the immunogen.TGF beta1 Antibody
The TGF beta1 Antibody is a highly specialized antibody that targets the transforming growth factor beta 1 (TGF-β1), a key protein involved in various biological processes. This antibody has been extensively researched and is widely used in Life Sciences for its ability to neutralize the effects of TGF-β1.Synapsin 1 antibody
The Synapsin 1 antibody is a highly specialized polyclonal antibody that is used in the field of Life Sciences. It is specifically designed to target and bind to Synapsin 1, a protein that plays a crucial role in synaptic vesicle trafficking and neurotransmitter release. This antibody can be used for various applications such as immunohistochemistry, western blotting, and ELISA.FAM81A antibody
FAM81A antibody was raised using the N terminal of FAM81A corresponding to a region with amino acids GDRLARLFLEEHIRNITAIVKQLNRDIEVLQEQIRARDNISYGTNSALKTCyclin B1 antibody
The Cyclin B1 antibody is a highly specific monoclonal antibody that targets the virus surface antigen, influenza hemagglutinin. It is widely used in Life Sciences research to study the role of cyclin B1 in cell cycle regulation and cellular processes. This antibody can be used for various applications, including immunohistochemistry, western blotting, and flow cytometry. The Cyclin B1 antibody has been shown to have high affinity and specificity for its target, making it an excellent tool for researchers studying cell division and proliferation. Additionally, this antibody has neutralizing activity against certain strains of influenza virus, making it a potential therapeutic candidate for antiviral treatments. With its exceptional performance and versatility, the Cyclin B1 antibody is a valuable asset in any laboratory setting.UBE2I antibody
UBE2I antibody was raised using a synthetic peptide corresponding to a region with amino acids MSGIALSRLAQERKAWRKDHPFGFVAVPTKNPDGTMNLMNWECAIPGKKG
