Anticorps primaires
Les anticorps primaires sont des immunoglobulines qui se lient spécifiquement à un antigène d'intérêt, permettant la détection et la quantification de protéines, peptides ou autres biomolécules. Ces anticorps sont des outils essentiels dans de nombreuses applications, notamment le Western blot, l'immunohistochimie et l'ELISA. Chez CymitQuimica, nous proposons une vaste sélection d'anticorps primaires de haute qualité, offrant spécificité et sensibilité pour divers besoins de recherche, notamment en cancérologie, immunologie et biologie cellulaire.
Sous-catégories appartenant à la catégorie "Anticorps primaires"
- Anticorps pour la recherche sur le cancer(3.721 produits)
- Anticorps cardio-vasculaires(2 produits)
- Biologie du développement(764 produits)
- Anticorps relatifs à l’épigénétique(162 produits)
- Anticorps d'immunologie(2.585 produits)
- Anticorps du métabolisme(286 produits)
- Anticorps de microbiologie(741 produits)
- Transduction du signal(2.765 produits)
- Tags & Marqueurs cellulaires(34 produits)
Affichez 1 plus de sous-catégories
75562 produits trouvés pour "Anticorps primaires"
Trier par
Degré de pureté (%)
0
100
|
0
|
50
|
90
|
95
|
100
MX1 antibody
The MX1 antibody is a highly specialized monoclonal antibody that targets the tyrosine kinase receptor. It is widely used in Life Sciences research and has various applications in the field. This antibody specifically binds to fibronectin, a protein involved in cell adhesion and migration. By targeting this receptor, the MX1 antibody can modulate cellular processes and signaling pathways.
FBXO4 antibody
FBXO4 antibody was raised using the middle region of FBXO4 corresponding to a region with amino acids KRMPCFYLAHELHLNLLNHPWLVQDTEAETLTGFLNGIEWILEEVESKRAGPR20 antibody
The GPR20 antibody is a highly effective antibody-drug that belongs to the class of antibodies. It is specifically designed to target and bind to GPR20, a protein receptor involved in various biological processes. This monoclonal antibody has been extensively studied and proven to have high specificity and affinity for GPR20.RPIA antibody
RPIA antibody was raised using a synthetic peptide corresponding to a region with amino acids MQRPGPFSTLYGRVLAPLPGRAGGAASGGGGNSWDLPGSHVRLPGRAQSGTRAF6 antibody
The TRAF6 antibody is a highly specialized protein that specifically targets TNF-α, a key cytokine involved in inflammation and immune response. By binding to TNF-α, the TRAF6 antibody inhibits its activity and reduces the inflammatory response in the body. This has been shown to have beneficial effects on various conditions related to excessive inflammation, such as autoimmune diseases and chronic inflammatory disorders.Tau antibody
The Tau antibody is a polyclonal antibody that is used in Life Sciences research. It specifically targets and binds to the tau protein, which plays a crucial role in the development of neurodegenerative diseases such as Alzheimer's disease. The antibody can be used for various applications, including immunohistochemistry, Western blotting, and ELISA assays.SDHB antibody
SDHB antibody was raised using a synthetic peptide corresponding to a region with amino acids YRWMIDSRDDFTEERLAKLQDPFSLYRCHTIMNCTRTCPKGLNPGKAIAESARS antibody
SARS antibody was raised using the C terminal of SARS corresponding to a region with amino acids PEKLKEFMPPGLQELIPFVKPAPIEQEPSKKQKKQHEGSKKKAAARDVTLGLUT5 antibody
The GLUT5 antibody is a highly effective and versatile tool used in various scientific and medical research applications. This monoclonal antibody specifically targets the GLUT5 protein, which plays a crucial role in the transportation of fructose across cell membranes.TP63 antibody
The TP63 antibody is a highly specialized product used in the field of Life Sciences. It is commonly used as a research tool in various experiments and studies. This antibody specifically targets the TP63 protein, which plays a crucial role in cell cycle regulation, development, and differentiation.
Focal Adhesion Kinase antibody
The Focal Adhesion Kinase antibody is a highly effective monoclonal antibody that targets and inhibits the activity of focal adhesion kinase (FAK). FAK is an important protein involved in cell signaling, cell adhesion, and cell migration. This antibody is specifically designed to bind to FAK and prevent its activation, thereby inhibiting the downstream signaling pathways that contribute to cancer progression.AKT antibody
Akt, also known as Protein Kinase B (PKB), is a serine/threonine-specific protein kinase that plays a vital role in cellular processes such as growth, survival, metabolism, and proliferation. As a central player in the PI3K/Akt/mTOR pathway, it integrates signals essential for cellular adaptation and function. Humans have three main Akt isoforms—Akt1, Akt2, and Akt3—each encoded by separate genes. Akt activation begins when external signals, such as growth factors or insulin, bind to cell surface receptors, activating phosphoinositide 3-kinase (PI3K). This leads to the production of PIP3 on the cell membrane, recruiting Akt and initiating two crucial phosphorylation steps at Thr308 and Ser473, after which Akt becomes fully activated and moves within the cell to phosphorylate its target proteins.Akt’s core functions include promoting cell survival by inhibiting apoptosis through phosphorylation of pro-apoptotic proteins like BAD and Caspase-9, and supporting cell growth and proliferation by activating mTOR, a key regulator of protein synthesis. It also plays a significant role in metabolic regulation, increasing glucose uptake and glycolysis through GLUT4 translocation and hexokinase activation, particularly in muscle and fat tissues. Additionally, Akt promotes angiogenesis by enhancing VEGF expression, which aids tissue repair, and supports cell migration, aiding wound healing but also facilitating cancer cell spread. Due to its extensive role in cell survival and growth, Akt is often hyperactivated in cancers, driving unchecked cell division and tumor progression, making it a target for cancer therapies. Its influence on glucose metabolism also connects Akt to insulin signaling, where pathway defects can impair glucose uptake, contributing to insulin resistance and type 2 diabetes.MIOX antibody
The MIOX antibody is a diagnostic biomarker that plays a crucial role in the field of medicine. It is a Monoclonal Antibody that specifically targets proline-rich proteins. This antibody has been extensively studied and proven to be an effective tool in various therapeutic applications, including as inhibitors and theranostics.Moesin antibody
The Moesin antibody is a highly specialized product used in the field of Life Sciences. It is derived from hybridoma cells and is colloidal in nature. This antibody is reactive towards aldehyde groups and can be used for various applications such as protein inhibition studies, detecting specific proteins, and studying protein kinase activity.MLKL antibody
MLKL antibody was raised using the N terminal of MLKL corresponding to a region with amino acids DVWKELSLLLQVEQRMPVSPISQGASWAQEDQQDADEDRRAFQMLRRDNE
PAX8 antibody
The PAX8 antibody is a highly specialized product in the field of Life Sciences. It is a monoclonal antibody that has been developed for its neutralizing and neuroprotective properties. This antibody specifically targets PAX8, a transcription factor involved in the development and function of cardiomyocytes.TUSC1 antibody
TUSC1 antibody was raised using the middle region of TUSC1 corresponding to a region with amino acids DSGREDEPGSPRALRARLEKLEAMYRRALLQLHLEQRGPRPSGDKEEQPLALAD antibody
ALAD antibody was raised using the N terminal of ALAD corresponding to a region with amino acids EEMLRPLVEEGLRCVLIFGVPSRVPKDERGSAADSEESPAIEAIHLLRKT
GRP78 antibody
The GRP78 antibody is a highly effective medicament that has been specifically designed to target and inhibit the activity of GRP78, an important protein in various cellular processes. This polyclonal antibody has been extensively tested and proven to be highly specific and potent in its inhibitory effects on GRP78.MRPL37 antibody
MRPL37 antibody was raised using the N terminal of MRPL37 corresponding to a region with amino acids VRSTRKSEPPPLDRVYEIPGLEPITFAGKMHFVPWLARPIFPPWDRGYKDVCAM1 antibody
The VCAM1 antibody is a highly specialized monoclonal antibody that has been developed for research and diagnostic purposes in the field of Life Sciences. It is designed to target and neutralize the VCAM1 antigen, which plays a crucial role in various biological processes, including inflammation and immune response.CYP11B2 antibody
CYP11B2 antibody was raised using the middle region of CYP11B2 corresponding to a region with amino acids RRLAEAEMLLLLHHVLKHFLVETLTQEDIKMVYSFILRPGTSPLLTFRAICRABP2 antibody
CRABP2 antibody was raised using the middle region of CRABP2 corresponding to a region with amino acids FEEQTVDGRPCKSLVKWESENKMVCEQKLLKGEGPKTSWTRELTNDGELI
STAT1 antibody
The STAT1 antibody is a monoclonal antibody that specifically targets the STAT1 protein complex. This antibody is widely used in the field of Life Sciences as a research tool and as a potential medicament. The STAT1 antibody has high specificity and affinity for the target protein, making it an ideal choice for various applications such as Western blotting, immunoprecipitation, and fluorescence measurement.ATP7A antibody
ATP7A antibody was raised using a synthetic peptide corresponding to a region with amino acids MKKQIEAMGFPAFVKKQPKYLKLGAIDVERLKNTPVKSSEGSQQRSPSYQNOVA1 antibody
NOVA1 antibody was raised using the C terminal of NOVA1 corresponding to a region with amino acids SKKGEFVPGTRNRKVTITGTPAATQAAQYLITQRITYEQGVRAANPQKVG
PTTG antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is specifically designed to combat tuberculosis infection by targeting active compounds and exhibiting bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, preventing transcription and replication, ultimately inhibiting bacterial growth. Extensive research has been conducted using the patch-clamp technique on human erythrocytes, demonstrating its high frequency of human activity. Furthermore, this drug undergoes various metabolic transformations such as hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Remarkably, it also binds to markers expressed at high levels in Mycobacterium tuberculosis strains and effectively inhibits cell growth in culture.EIF4G2 antibody
EIF4G2 antibody was raised using the C terminal of EIF4G2 corresponding to a region with amino acids KGFVNILMTSFLQYISSEVNPPSDETDSSSAPSKEQLEQEKQLLLSFKPVNMDAR2B antibody
The NMDAR2B antibody is a highly specialized polyclonal antibody used in the field of Life Sciences. It is designed to target and neutralize the NMDA receptor subunit 2B (NMDAR2B), which plays a crucial role in neuronal function and synaptic plasticity. This antibody can be used for various applications, including Western blotting, immunohistochemistry, and immunofluorescence.
WDTC1 antibody
WDTC1 antibody was raised using the N terminal of WDTC1 corresponding to a region with amino acids PMWPNTFWSAAEDGLIRQYDLRENSKHSEVLIDLTEYCGQLVEAKCLTVNNANP antibody
The NANP antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It is designed to immobilize and detect specific growth factors, such as collagen and epidermal growth factor (EGF), in various research applications. This antibody is generated through the use of advanced techniques, including electrode-based immunization and hybridoma technology.AKAP12 antibody
The AKAP12 antibody is a polyclonal antibody that is widely used in life sciences research. It is commonly used in immunoassays to detect the presence and measure the levels of AKAP12 protein in various samples. This antibody specifically binds to AKAP12, which is an endonuclease that plays a crucial role in regulating several cellular processes.SUV39H2 antibody
The SUV39H2 antibody is a powerful tool in the field of Life Sciences. It specifically targets and inhibits the activity of the SUV39H2 methyltransferase, a key enzyme involved in the modification of DNA molecules. By inhibiting this enzyme, the antibody prevents the addition of methyl groups to specific nucleotide sequences, thereby affecting gene expression and protein production.FLJ40504 antibody
FLJ40504 antibody was raised using the N terminal of FLJ40504 corresponding to a region with amino acids MDHCLISGLSQLDLPSALTKNWPSKPESCPLALLPGQHELHHLLHPLHQLHER2 antibody
The HER2 antibody is a highly effective monoclonal antibody that targets the HER2 protein, which is overexpressed in certain types of cancer cells. This antibody has a high affinity for the HER2 receptor and can effectively block its signaling pathway, inhibiting tumor growth and proliferation.EIF5 antibody
EIF5 antibody was raised using the N terminal of EIF5 corresponding to a region with amino acids SVNVNRSVSDQFYRYKMPRLIAKVEGKGNGIKTVIVNMVDVAKALNRPPTACTR1B antibody
ACTR1B antibody was raised using a synthetic peptide corresponding to a region with amino acids KIKISAPQERLYSTWIGGSILASLDTFKKMWVSKKEYEEDGSRAIHRKTFFBXO27 antibody
FBXO27 antibody was raised using the middle region of FBXO27 corresponding to a region with amino acids LDKFSAVPDPIPQWNNNACLHVTHVFSNIKMGVRFVSFEHRGQDTQFWAGDHX9 antibody
DHX9 antibody was raised using a synthetic peptide corresponding to a region with amino acids GLHGNWTLENAKARLNQYFQKEKIQGEYKYTQVGPDHNRSFIAEMTIYIKACAD10 antibody
The ACAD10 antibody is a highly specialized product in the field of Life Sciences. It serves as a serum marker and biochemical tool for various research applications, particularly in the study of pluripotent stem cells. This antibody specifically targets mesothelin, a glycoprotein that plays a crucial role in cell signaling and differentiation.
Myeloperoxidase antibody
Myeloperoxidase antibody was raised in mouse using human myeloperoxidase as the immunogen.PTS antibody
The PTS antibody is a highly specialized antibody used in the field of Life Sciences. It is designed to target specific proteins and molecules involved in various biological processes. This antibody can be used in research settings to study the role of these proteins and their interactions with other molecules.LYSMD1 antibody
LYSMD1 antibody was raised using the N terminal of LYSMD1 corresponding to a region with amino acids VRERRLEHQLEPGDTLAGLALKYGVTMEQIKRANRLYTNDSIFLKKTLYI14-3-3 theta antibody
The 14-3-3 theta antibody is an essential tool in Life Sciences research. It is a high-quality antibody that specifically targets the 14-3-3 theta protein. This protein plays a crucial role in various cellular processes, including signal transduction, cell cycle regulation, and apoptosis.CDC5L antibody
CDC5L antibody was raised in mouse using recombinant Human Cdc5 Cell Division Cycle 5-Like (S. Pombe) (Cdc5L)PEX5 antibody
The PEX5 antibody is a monoclonal antibody that has been specifically designed to target and neutralize the activity of PEX5, a protein involved in various cellular processes. This antibody is activated and reactive, making it highly effective in inhibiting the function of PEX5.MIA antibody
The MIA antibody is a polyclonal antibody that specifically targets annexin A2. It is widely used in the field of Life Sciences for various applications, including research and diagnostics. The MIA antibody has shown high affinity and specificity towards its target, making it a valuable tool in studying the role of annexin A2 in different biological processes.
COG4 antibody
COG4 antibody was raised using the middle region of COG4 corresponding to a region with amino acids LFSQGIGGEQAQAKFDSCLSDLAAVSNKFRDLLQEGLTELNSTAIKPQVQ
C1ORF43 antibody
C1ORF43 antibody was raised using the middle region of C1Orf43 corresponding to a region with amino acids YQEALSELATAVKARIGSSQRHHQSAAKDLTQSPEVSPTTIQVTYLPSSQFGF21 antibody
The FGF21 antibody is a cytotoxic monoclonal antibody that targets the surface glycoprotein and is used in immunoassays. It has been shown to have potential therapeutic applications in Life Sciences, particularly in the field of gluconeogenesis regulation. The FGF21 antibody can be used as a treatment option in combination with high-dose chemotherapy or multiagent chemotherapy, and it has also shown promise when combined with histone deacetylase inhibitors. Additionally, this antibody exhibits natriuretic and growth factor properties, making it a versatile tool in various research and clinical settings.
NR5A1 antibody
NR5A1 antibody was raised using the middle region of NR5A1 corresponding to a region with amino acids LQLEPDEDQVRARILGCLQEPTKSRPDQPAAFGLLCRMADQTFISIVDWA
