Anticorps primaires
Les anticorps primaires sont des immunoglobulines qui se lient spécifiquement à un antigène d'intérêt, permettant la détection et la quantification de protéines, peptides ou autres biomolécules. Ces anticorps sont des outils essentiels dans de nombreuses applications, notamment le Western blot, l'immunohistochimie et l'ELISA. Chez CymitQuimica, nous proposons une vaste sélection d'anticorps primaires de haute qualité, offrant spécificité et sensibilité pour divers besoins de recherche, notamment en cancérologie, immunologie et biologie cellulaire.
Sous-catégories appartenant à la catégorie "Anticorps primaires"
- Anticorps pour la recherche sur le cancer(3.721 produits)
- Anticorps cardio-vasculaires(2 produits)
- Biologie du développement(764 produits)
- Anticorps relatifs à l’épigénétique(162 produits)
- Anticorps d'immunologie(2.585 produits)
- Anticorps du métabolisme(286 produits)
- Anticorps de microbiologie(741 produits)
- Transduction du signal(2.765 produits)
- Tags & Marqueurs cellulaires(34 produits)
Affichez 1 plus de sous-catégories
75562 produits trouvés pour "Anticorps primaires"
Trier par
Degré de pureté (%)
0
100
|
0
|
50
|
90
|
95
|
100
Factor IX antibody (HRP)
Factor IX antibody (HRP) was raised in goat using human Factor IX purified from plasma as the immunogen.
CFDP1 antibody
CFDP1 antibody was raised using the middle region of CFDP1 corresponding to a region with amino acids GSGLKRSSGMSSLLGKIGAKKQKMSTLEKSKLDWESFKEEEGIGEELAIHHNF4 alpha antibody
The HNF4 alpha antibody is a highly effective reagent used in the field of Life Sciences. It has the ability to inhibit the function of hematopoietic and pluripotent stem cells, making it a valuable tool for research and therapeutic applications. This antibody can be used in immunohistochemical studies to detect the presence of HNF4 alpha protein in various tissues and cell types. It is a polyclonal antibody, meaning it recognizes multiple epitopes on the target protein, resulting in high specificity and sensitivity. With its ability to accurately detect HNF4 alpha, researchers can gain valuable insights into the role of this protein in cellular processes and disease mechanisms. Whether you are studying cytokines or pluripotent stem cells, this HNF4 alpha antibody is an essential tool for your research needs.GLS2 antibody
GLS2 antibody was raised using a synthetic peptide corresponding to a region with amino acids FVGKEPSGLRYNKLSLNEEGIPHNPMVNAGAIVVSSLIKMDCNKAEKFDFHDAC5 antibody
The HDAC5 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. This antibody specifically targets and binds to HDAC5, which stands for Histone Deacetylase 5. HDAC5 is an enzyme involved in the regulation of gene expression by modifying histones, which are proteins that help package DNA in cells. By binding to HDAC5, this antibody can modulate its activity and potentially impact various cellular processes.SOX17 antibody
The SOX17 antibody is a monoclonal antibody that specifically targets glucagon, a hormone involved in regulating blood sugar levels. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in various applications. It can be used to detect and measure glucagon levels in human serum, making it a valuable tool for research and diagnostic purposes. Additionally, the SOX17 antibody has been found to have cytotoxic effects on certain cancer cells, making it a potential candidate for targeted therapy. Its high specificity and affinity for glucagon make it an ideal choice for experiments involving the detection and manipulation of this hormone. Whether you are studying the role of glucagon in diabetes or investigating its interaction with other molecules such as insulin or collagen, the SOX17 antibody is an indispensable tool that will provide reliable and accurate results.TFEB antibody
The TFEB antibody is a highly specialized product in the field of Life Sciences. It is designed to specifically bind to the TFEB receptor, which plays a crucial role in various cellular processes such as glucagon signaling and collagen synthesis. This antibody is widely used in research laboratories for studying the function and regulation of TFEB.Helicobacter pylori antibody
The Helicobacter pylori antibody is a monoclonal antibody used in Life Sciences research. It is designed to specifically target and bind to the helicobacter bacteria, allowing for the detection and study of this pathogen. The antibody can be used in various applications, such as immunoassays and immunohistochemistry, to identify and quantify the presence of helicobacter in samples. Additionally, this antibody has been shown to have cytotoxic effects on helicobacter cells, making it a valuable tool for studying the mechanisms of bacterial infection and developing new therapeutic strategies. With its high specificity and affinity, the Helicobacter pylori antibody is an essential component in research related to infectious diseases and microbiology.CD18 antibody
CD18 antibody was raised in mouse using leucocytes from LGL-type leukemia as the immunogen.NFkB p65 antibody
The NFkB p65 antibody is a polyclonal antibody that is used for various applications in the field of Life Sciences. It is specifically designed to target and neutralize the NFkB p65 protein, which plays a crucial role in cellular signaling pathways. This antibody can be used for techniques such as hybridization, immunoprecipitation, and immunofluorescence.ALOX15B antibody
ALOX15B antibody was raised using the C terminal of ALOX15B corresponding to a region with amino acids ATCEGFIATLPPVNATCDVILALWLLSKEPGDQRPLGTYPDEHFTEEAPRC2ORF29 antibody
C2ORF29 antibody was raised using the middle region of C2Orf29 corresponding to a region with amino acids SVDISGLQLALAERQSELPTQSKASFPSILSDPDPDSSNSGFDSSVASQIGPC5 antibody
The GPC5 antibody is a highly specialized Polyclonal Antibody that targets the lipoprotein lipase, an enzyme involved in lipid metabolism. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in various applications. It specifically binds to GPC5, a growth factor that plays a crucial role in adipose tissue development and function.Rabbit anti Mouse IgG3 (HRP)
Rabbit anti-mouse IgG3 (HRP) was raised in rabbit using murine IgG3 heavy chain as the immunogen.RNF121 antibody
RNF121 antibody was raised using the N terminal of RNF121 corresponding to a region with amino acids WWRFLVIWILFSAVTAFVTFRATRKPLVQTTPRLVYKWFLLIYKISYATGCARS antibody
CARS antibody was raised using the C terminal of CARS corresponding to a region with amino acids KRKKKEEAARRKQEQEAAKLAKMKIPPSEMFLSETDKYSKFDENGLPTHD
PBEF1 antibody
PBEF1 antibody was raised using the C terminal of PBEF1 corresponding to a region with amino acids VTLEEGKGDLEEYGQDLLHTVFKNGKVTKSYSFDEIRKNAQLNIELEAAHp53 antibody
The p53 antibody is a highly specific monoclonal antibody that is used in various research and diagnostic applications. It is designed to target and bind to the p53 protein, which plays a crucial role in regulating cell growth and preventing tumor formation. This antibody can be used for immunohistochemistry, Western blotting, flow cytometry, and other techniques to detect and analyze the expression of p53 in different samples.ICK antibody
The ICK antibody is a powerful tool in Life Sciences research. This polyclonal antibody specifically targets the protein ICK, which plays a crucial role in various cellular processes. By binding to ICK, this antibody can be used to study its function and regulation.Tau antibody
The Tau antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It specifically targets and neutralizes the activity of tau protein, which is involved in the formation of neurofibrillary tangles found in Alzheimer's disease and other neurodegenerative disorders. This antibody has been extensively studied and proven to effectively bind to tau protein, inhibiting its aggregation and promoting its clearance from brain cells.CCDC7 antibody
CCDC7 antibody was raised using the N terminal of CCDC7 corresponding to a region with amino acids KHNAKLIHDKIEPMVLRSPPTGESILRYALPIPSSKTKNLLPEDEMIGKIADAD2 antibody
ADAD2 antibody was raised using the C terminal of ADAD2 corresponding to a region with amino acids TPDTCRGLSLNWSLGDPGIEVVDVATGRVKANAALGPPSRLCKASFLRAFSynaptojanin 1 antibody
Synaptojanin 1 antibody was raised using the middle region of SYNJ1 corresponding to a region with amino acids PGVARREMEAPKSPGTTRKDNIGRSQPSPQAGLAGPGPAGYSTARPTIPPLipase J antibody
Lipase J antibody was raised using the C terminal of LIPJ corresponding to a region with amino acids LNLVHYNQTTSPLYNMTNMNVATAIWNGKSDLLADPEDVNILHSEITNHI
KLK1 antibody
The KLK1 antibody is a polyclonal antibody that is used in life sciences research. It is designed to target and neutralize the effects of acetylcholine, interferon, chemokine, and other molecules involved in intraocular endothelial growth. This antibody has been shown to be effective in blocking the activity of these molecules, thereby inhibiting their effects on cell growth and function. Additionally, the KLK1 antibody can be used to detect the presence of autoantibodies or test compounds in biological samples. Its high specificity and affinity make it an essential tool for researchers studying growth factors and their role in various physiological processes.
STAT1 antibody
The STAT1 antibody is a highly specialized monoclonal antibody that targets the signal transducer and activator of transcription 1 (STAT1) protein. This antibody is commonly used in life sciences research to study various cellular processes, including growth factor signaling, insulin regulation, and immune responses.
CD325 antibody
The CD325 antibody is a highly specialized monoclonal antibody that targets β-catenin, a protein involved in cell adhesion and signaling pathways. It is commonly used in life sciences research to study the role of β-catenin in various cellular processes. The CD325 antibody specifically recognizes the non-phosphorylated form of β-catenin, allowing for precise detection and analysis.SMUG1 antibody
The SMUG1 antibody is a highly specific and potent antibody that can be used in various applications in the field of Life Sciences. It is available as both polyclonal and monoclonal antibodies, providing researchers with flexibility in their experimental design.
Cyclin E1 antibody
Human synthetic cyclin E1 central region KLH-conjugated immunogen; purified polyclonal Cyclin E1 antibody; cross reative mouse, rat, bovine, dog, pigcKit antibody
The cKit antibody is a powerful tool used in Life Sciences for various applications. This antibody specifically binds to the cKit receptor, which is involved in the regulation of hematopoiesis and is crucial for the development of blood cells. By targeting this receptor, the cKit antibody can be used to study thrombocytopenia and other disorders related to platelet production.CDH13 antibody
The CDH13 antibody is a powerful tool in the field of Life Sciences. It is a collagen inhibitor that has been extensively studied for its antinociceptive properties. This antibody can be used for immunohistochemical detection of CDH13 and its phosphorylation site, making it an essential tool for researchers studying cell signaling pathways. Additionally, the CDH13 antibody has been shown to have inhibitory effects on HDAC (histone deacetylase) and methyl transferase enzymes, which play crucial roles in gene expression regulation. Furthermore, this antibody has been found to interact with 6-phosphogluconate dehydrogenase, suggesting potential therapeutic applications in metabolic disorders. With its versatility and specificity, the CDH13 antibody is an invaluable asset in the development of new medicines and targeted therapies.5HT2B antibody
The 5HT2B antibody is a hematopoietic protein that can be used therapeutically as a biomarker. It is commonly used in immunohistochemical methods to detect the presence of specific antigens in tissues. This antibody is widely used in life sciences research as a reagent for various applications, including immunohistochemical staining and the study of inhibitors and cytokines. Additionally, the 5HT2B antibody plays a crucial role in pluripotent stem cell research and can be utilized to identify and characterize these cells. With its high specificity and sensitivity, this antibody is an essential tool for scientists working in the field of molecular biology and cellular research.cMyc antibody
The cMyc antibody is a highly versatile antibody used in various research applications in the field of Life Sciences. It can be used as both polyclonal and monoclonal antibodies, making it suitable for different experimental setups. This antibody specifically targets the cMyc protein, which plays a crucial role in cell growth and proliferation.Progesterone Receptor Antibody
The Progesterone Receptor Antibody is a powerful tool used in Life Sciences research. This monoclonal antibody specifically targets the progesterone receptor, which plays a crucial role in reproductive processes and hormone signaling. The antibody is designed to recognize the activated form of the progesterone receptor, allowing for precise detection and analysis.Carboxypeptidase X antibody
Carboxypeptidase X antibody was raised using a synthetic peptide corresponding to a region with amino acids MNDFSYLHTNCFEVTVELSCDKFPHENELPQEWENNKDALLTYLEQVRMGRAN antibody
RAN antibody is a highly effective neutralizing agent that targets cyclase-activating fatty acid receptors. This polyclonal antibody has been extensively tested and proven to inhibit the activity of these receptors, which play a crucial role in low-density lipoprotein metabolism. The RAN antibody is also capable of blocking interferon signaling pathways, making it an invaluable tool for researchers studying the immune response. In addition to its high specificity, this monoclonal antibody is formulated with excipients that ensure stability and long shelf life. It can be used in various assays, including IFN-gamma detection and antigen detection. With its exceptional binding affinity and reliable performance, the RAN antibody is a valuable asset for any laboratory or research facility working on lipid metabolism or immune system studies.CTDSP2 antibody
CTDSP2 antibody was raised using a synthetic peptide corresponding to a region with amino acids MEHGSIITQARREDALVLTKQGLVSKSSPKKPRGRNIFKALFCCFRAQHV
