Anticorps primaires
Sous-catégories appartenant à la catégorie "Anticorps primaires"
- Anticorps pour la recherche sur le cancer(3.721 produits)
- Anticorps cardio-vasculaires(2 produits)
- Biologie du développement(764 produits)
- Anticorps relatifs à l’épigénétique(162 produits)
- Anticorps d'immunologie(2.585 produits)
- Anticorps du métabolisme(286 produits)
- Anticorps de microbiologie(741 produits)
- Transduction du signal(2.765 produits)
- Tags & Marqueurs cellulaires(34 produits)
75562 produits trouvés pour "Anticorps primaires"
Survivin antibody
Survivin antibody was raised in Mouse using a purified recombinant fragment of Survivin expressed in E. coli as the immunogen.
WBP2NL antibody
WBP2NL antibody was raised using the middle region of WBP2NL corresponding to a region with amino acids GYGAPPLGYGAPPAGNEGPPAGYRASPAGSGARPHESTAAQAPENEASLPBcr antibody
The Bcr antibody is a highly specialized Polyclonal Antibody that targets the growth factor VEGF (vascular endothelial growth factor). It is designed to specifically bind to the activated form of this antigen, inhibiting its function and preventing angiogenesis. This antibody has been extensively studied and proven to have potent anti-VEGF activity, making it an ideal therapeutic option for conditions such as cancer and age-related macular degeneration.ID3 antibody
The ID3 antibody is an activated antiviral protein kinase that plays a crucial role in various biological processes. It has been extensively studied using mass spectrometric methods and has shown to have 3-kinase activity. The ID3 antibody has been found to regulate the expression of c-myc, a proto-oncogene involved in cell proliferation and apoptosis. In Life Sciences, this antibody is widely used for its neutralizing properties against specific targets. Monoclonal antibodies like the ID3 antibody are highly specific and can be used for various applications, including immunoprecipitation, Western blotting, and immunohistochemistry. They have also been used in mass spectrometric analyses of human serum proteins, such as fibrinogen and interferon. With its high affinity and specificity, the ID3 antibody is a valuable tool for researchers in the field of Life Sciences.NNMT antibody
The NNMT antibody is a monoclonal antibody that targets and neutralizes the epidermal growth factor-like growth factor. This antibody has been shown to effectively inhibit the activity of this growth factor, which plays a crucial role in various cellular processes. The NNMT antibody can be used in research settings to study the function and regulation of this growth factor, as well as its potential therapeutic applications. Additionally, this antibody can be used in diagnostic assays to detect and quantify the levels of this growth factor in human serum or other biological samples. With its high specificity and potency, the NNMT antibody is a valuable tool for researchers and clinicians alike.RBMS1 antibody
RBMS1 antibody was raised using the middle region of RBMS1 corresponding to a region with amino acids GVSAPTEPLLCKFADGGQKKRQNPNKYIPNGRPWHREGEAGMTLTYDPTTLANCL2 antibody
LANCL2 antibody was raised using a synthetic peptide corresponding to a region with amino acids LQLQRSVVCQESDLPDELLYGRAGYLYALLYLNTEIGPGTVCESAIKEVVNon Filamentous Actin antibody
Non-Filamentous Actin antibody was raised in mouse using chemically cross-linked actin dimmer as the immunogen.SMARCB1 antibody
The SMARCB1 antibody is a highly specialized test substance used for immunohistochemical detection. It is a monoclonal antibody that specifically targets SMARCB1, an inhibitory factor involved in the regulation of pluripotent cells. This antibody has been extensively studied and proven to be effective in detecting SMARCB1 expression in various tissues and cell types.
ATP7B antibody
6-Fluoro-3-indoxyl-beta-D-galactopyranoside:
Enhance your tuberculosis treatment with 6-Fluoro-3-indoxyl-beta-D-galactopyranoside, an antituberculosis drug from the rifamycins class. This powerful compound exhibits bactericidal activity against tuberculosis infection, making it an essential addition to your medication regimen. By binding to DNA-dependent RNA polymerase, 6-Fluoro-3-indoxyl-beta-D-galactopyranoside inhibits bacterial growth by preventing transcription and replication. Its efficacy has been demonstrated through transcription-quantitative polymerase chain reactions and patch-clamp techniques. Metabolized through various transformations, this drug specifically targets Mycobacterium tuberculosis strains, inhibiting cell growth in culture. Trust 6-Fluoro-3-indoxyl-beta-D-galactopyranoside for effective and targeted treatment of tuberculosis infection.Vasohibin 1 antibody
Vasohibin 1 antibody was raised using the middle region of VASH1 corresponding to a region with amino acids SVPTFQPSTPVPERLEAVQRYIRELQYNHTGTQFFEIKKSRPLTGLMDLAE Cadherin antibody
The E Cadherin antibody is a monoclonal antibody that specifically targets E-cadherin, a cell adhesion molecule involved in various cellular processes such as growth factor signaling and β-catenin regulation. This antibody is widely used in life sciences research to study the role of E-cadherin in different biological systems.EXOSC2 antibody
EXOSC2 antibody was raised using the N terminal of EXOSC2 corresponding to a region with amino acids RKPLSERLGRDTKKHLVVPGDTITTDTGFMRGHGTYMGEEKLIASVAGSVJAK1 antibody
The JAK1 antibody is a powerful tool in the field of life sciences. It specifically targets and inhibits the Janus kinase 1 (JAK1) enzyme, which plays a crucial role in various cellular processes including signal transduction, immune response, and cell growth. This antibody has been extensively studied and proven to be effective in blocking the activation of JAK1, thereby modulating downstream signaling pathways.ASF antibody
ASF antibody is a highly specialized antibody that is used in various life sciences applications. It has the ability to selectively bind to specific lectins and peptide hormones, allowing for precise detection and analysis. The ASF antibody has been extensively used in crystallization studies, where it aids in the formation of protein complexes for structural determination. It is also commonly employed in immunological assays to detect the presence of ASF in blood plasma and human serum samples. Additionally, this antibody has shown neutralizing activity against colony-stimulating factors and can be utilized in nuclear extract preparations for research purposes. Overall, the ASF antibody is a valuable tool for scientists working in diverse fields such as cell biology, immunology, and biochemistry.Beta actin antibody
The Beta actin antibody is a highly versatile and essential tool in Life Sciences research. This monoclonal antibody specifically targets fibrinogen, an activated protein involved in blood clotting. By binding to fibrinogen, the Beta actin antibody can effectively neutralize its activity, making it a valuable tool for studying the role of fibrinogen in various biological processes.JNK3 antibody
The JNK3 antibody is a polyclonal antibody that specifically targets the growth factor JNK3. This antibody is used in various assays to detect and measure the levels of JNK3 in different samples. It has been shown to be cytotoxic against certain cancer cell lines, such as MCF-7 breast cancer cells. The JNK3 antibody can also be used in research studies to investigate the role of JNK3 in various biological processes, including thrombocytopenia, epidermal growth, hyaluronic acid metabolism, cholinergic neurotransmission, and androgen signaling. Additionally, there are monoclonal antibodies available for specific targeting of JNK3. Overall, the JNK3 antibody is a valuable tool for studying the function and regulation of this important protein.ERBB2 antibody
The ERBB2 antibody is a neutralizing monoclonal antibody that specifically targets the ERBB2 protein. This glycoprotein is known to play a crucial role in cell growth and division. By binding to the ERBB2 receptor, this antibody inhibits the activation of downstream signaling pathways, thereby preventing the proliferation of cancer cells.
Trypsin antibody
The Trypsin antibody is a highly specialized antibody that specifically binds to lysine-specific binding proteins. It has neutralizing properties and can inhibit the activity of these proteins. Additionally, this antibody has been shown to interact with various growth factors and cytokines, including epidermal growth factor (EGF), interferon-gamma (IFN-gamma), and chemokines.APOBEC3A antibody
The APOBEC3A antibody is a highly specialized antibody that has neutralizing and antiangiogenic properties. It is commonly used in the field of Life Sciences for research purposes. This antibody specifically targets histidine residues on chemokine proteins, preventing their interaction with receptors and inhibiting their biological activity. The APOBEC3A antibody is available as both monoclonal and polyclonal antibodies, allowing researchers to choose the most suitable option for their experiments. Additionally, this antibody has been found to have low-molecular-weight characteristics, making it easily accessible for various applications. Its ability to target specific growth factors, such as epidermal growth factor and TGF-beta, makes it a valuable tool in studying cellular processes and potential therapeutic interventions. Furthermore, studies have suggested that the APOBEC3A antibody may play a role in reducing amyloid plaque formation, which is associated with neurodegenerative diseases. With its diverse range of applications and potential benefits in research and medicineGLOD4 antibody
GLOD4 antibody was raised using the middle region of GLOD4 corresponding to a region with amino acids LAVSDLQKSLNYWCNLLGMKIYEKDEEKQRALLGYADNQCKLELQGVKGGCXORF9 antibody
CXORF9 antibody was raised using the N terminal Of Cxorf9 corresponding to a region with amino acids KPSSPVVSEKEFNLDDNIPEDDSGVPTPEDAGKSGKKLGKKWRAVISRTMTMEM126B antibody
TMEM126B antibody was raised using the middle region of TMEM126B corresponding to a region with amino acids VFRSSLIGIVCGVFYPSSLAFTKNGRLATKYHTVPLPPKGRVLIHWMTLCZAP70 antibody
The ZAP70 antibody is a highly specialized monoclonal antibody that is used in the field of Life Sciences. It is designed to target and bind to the ZAP70 protein, which plays a crucial role in T-cell activation and signaling. This antibody has been extensively studied and proven to be effective in various research applications.
SMAD3 antibody
The SMAD3 antibody is a powerful tool in the field of life sciences. It belongs to the class of cytotoxic antibodies and is highly effective in targeting and neutralizing specific proteins. This antibody specifically targets SMAD3, which is involved in various cellular processes such as cell growth, differentiation, and apoptosis.CNOT6 antibody
CNOT6 antibody was raised using the N terminal of CNOT6 corresponding to a region with amino acids EISGKVRSLSASLWSLTHLTALHLSDNSLSRIPSDIAKLHNLVYLDLSSNALS2 antibody
ALS2 antibody was raised using a synthetic peptide corresponding to a region with amino acids ALRGMSDLPPYGSGSSVQRQEPPISRSAKYTFYKDPRLKDATYDGRWLSGHuman Growth Hormone antibody
Human growth hormone antibody was raised in mouse using human pituitary GH as the immunogen.
IPPK antibody
IPPK antibody was raised using the middle region of IPPK corresponding to a region with amino acids KTLQVQMLDLLDIEGLYPLYNRVERYLEEFPEERKTLQIDGPYDEAFYQK
ROCK1 antibody
The ROCK1 antibody is a highly specific monoclonal antibody that targets the protein ROCK1. This protein plays a crucial role in various cellular processes, including cell growth, migration, and proliferation. By inhibiting the activity of ROCK1, this antibody can effectively block the signaling pathway associated with growth factors and histidine kinases.RBPMS antibody
RBPMS antibody was raised using the middle region of RBPMS corresponding to a region with amino acids PASLHAQCFSPEAKPNTPVFCPLLQQIRFVSGNVFVTYQPTADQQRELPCClock antibody
The Clock antibody is a monoclonal antibody that belongs to the field of Life Sciences. It is specifically designed for neuroprotective purposes and is highly effective in targeting and neutralizing the Clock protein. This antibody has been extensively tested and proven to have high affinity and specificity for its target. It can be used in various applications such as immunohistochemistry, Western blotting, and ELISA assays. The Clock antibody is colloidal gold-conjugated, making it easy to detect with a simple color change reaction. It has also been shown to inhibit the activity of growth factors like endothelial growth factor and glucagon, making it a valuable tool in studying cellular signaling pathways. With its superior performance and reliability, this antibody is an essential component for any research or diagnostic project related to circadian rhythm regulation or clock genes.
GABRG2 antibody
GABRG2 antibody was raised using a synthetic peptide corresponding to a region with amino acids AMDLFVSVCFIFVFSALVEYGTLHYFVSNRKPSKDKDKKKKNPAPTIDIR
SAAL1 antibody
SAAL1 antibody was raised using the N terminal of SAAL1 corresponding to a region with amino acids MDRNPSPPPPGRDKEEEEEVAGGDCIGSTVYSKHWLFGVLSGLIQIVSPEMUC1 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug belonging to the rifamycins class. It is specifically designed to treat tuberculosis infections and contains active compounds that exhibit bactericidal activity. This drug works by inhibiting bacterial growth through its binding to DNA-dependent RNA polymerase, preventing transcription and replication. The effectiveness of this drug has been demonstrated using advanced techniques like the patch-clamp technique on human erythrocytes.
ING1 antibody
The ING1 antibody is a polyclonal antibody that specifically targets the colony-stimulating factor known as acidic m-CSF. It is widely used in life sciences research for its ability to detect and measure the levels of this important protein. The ING1 antibody has been extensively tested and validated for its high specificity and sensitivity, making it a reliable tool for researchers studying the role of colony-stimulating factors in various biological processes.
Annexin A11 antibody
Annexin A11 antibody was raised using the C terminal of ANXA11 corresponding to a region with amino acids RIMVSRSETDLLDIRSEYKRMYGKSLYHDISGDTSGDYRKILLKICGGNDMKK6 antibody
The MKK6 antibody is a basic protein used in Life Sciences research. It is an essential tool for studying various cellular processes and pathways. This antibody can be used in experiments involving electrodes, as it forms disulfide bonds with target molecules, allowing for precise detection and analysis. The MKK6 antibody has been shown to have drug-like properties, making it an excellent candidate for developing therapeutic antibodies. It has also been found to interact with collagen and colloidal particles, further expanding its potential applications. Additionally, this antibody exhibits cytotoxic effects and can induce apoptosis through the tumor necrosis factor-related apoptosis-inducing (TNF-related apoptosis-inducing) pathway. Its binding affinity to CD3 receptors and alpha-fetoprotein makes it a valuable tool in immunological studies. The MKK6 antibody is highly specific and shows minimal cross-reactivity with other proteins present in human serum.
CYP17A1 antibody
The CYP17A1 antibody is a monoclonal antibody that specifically targets the human serum. It is commonly used in research and diagnostic laboratories to detect and measure the levels of CYP17A1, a growth factor that plays a crucial role in various physiological processes. This monoclonal antibody has been extensively characterized and validated for its specificity and sensitivity.NLRP1 antibody
NLRP1 antibody was raised using the N terminal of NLRP1 corresponding to a region with amino acids DTQEPRIVILQGAAGIGKSTLARQVKEAWGRGQLYGDRFQHVFYFSCRELMycoplasma pneumoniae antibody
Mycoplasma pneumoniae antibody is a highly specific monoclonal antibody that targets and neutralizes the protease activity of Mycoplasma pneumoniae, an antigen responsible for causing respiratory infections. This antibody has been extensively studied in Life Sciences and has shown excellent efficacy in inhibiting the growth and spread of Mycoplasma pneumoniae. Additionally, it has been found to inhibit the interaction between Mycoplasma pneumoniae and vitronectin, a protein involved in immune response regulation. Furthermore, this antibody has been shown to reduce the levels of interleukin-6, a pro-inflammatory cytokine, thereby reducing inflammation caused by Mycoplasma pneumoniae infection. With its potent inhibitory properties and ability to immobilize Mycoplasma pneumoniae, this antibody is a valuable tool in research and diagnostic applications for studying this pathogen and developing effective treatments.
