Anticorps primaires
Les anticorps primaires sont des immunoglobulines qui se lient spécifiquement à un antigène d'intérêt, permettant la détection et la quantification de protéines, peptides ou autres biomolécules. Ces anticorps sont des outils essentiels dans de nombreuses applications, notamment le Western blot, l'immunohistochimie et l'ELISA. Chez CymitQuimica, nous proposons une vaste sélection d'anticorps primaires de haute qualité, offrant spécificité et sensibilité pour divers besoins de recherche, notamment en cancérologie, immunologie et biologie cellulaire.
Sous-catégories appartenant à la catégorie "Anticorps primaires"
- Anticorps pour la recherche sur le cancer(3.721 produits)
- Anticorps cardio-vasculaires(2 produits)
- Biologie du développement(764 produits)
- Anticorps relatifs à l’épigénétique(162 produits)
- Anticorps d'immunologie(2.585 produits)
- Anticorps du métabolisme(286 produits)
- Anticorps de microbiologie(741 produits)
- Transduction du signal(2.765 produits)
- Tags & Marqueurs cellulaires(34 produits)
Affichez 1 plus de sous-catégories
75594 produits trouvés pour "Anticorps primaires"
Trier par
Degré de pureté (%)
0
100
|
0
|
50
|
90
|
95
|
100
HSPA6 antibody
HSPA6 antibody was raised using a synthetic peptide corresponding to a region with amino acids EYEHQKRELEQICRPIFSRLYGGPGVPGGSSCGTQARQGDPSTGPIIEEVTMCC3 antibody
TMCC3 antibody was raised using the N terminal of TMCC3 corresponding to a region with amino acids MPGSDTALTVDRTYSDPGRHHRCKSRVERHDMNTLSLPLNIRRGGSDTNLDegré de pureté :Min. 95%APOA1BP antibody
The APOA1BP antibody is a highly specific monoclonal antibody that targets the phosphatase enzyme. It has been extensively studied for its ability to inhibit epidermal growth factor signaling pathways. This antibody is widely used in research and diagnostic applications, including the detection of various proteins such as insulin, alpha-fetoprotein, and dopamine. The APOA1BP antibody can be used in a variety of assays, including tyrosine phosphorylation assays and neutralizing assays for growth factors. It is available in both polyclonal and monoclonal forms, providing researchers with options for their specific experimental needs. With its high specificity and sensitivity, this antibody is an invaluable tool for studying cellular signaling pathways and protein interactions.MMP14 antibody
The MMP14 antibody is a powerful tool in the field of molecular biology and research. It is an insulin-like growth factor-binding protein that plays a crucial role in various cellular processes. This antibody specifically targets and binds to MMP14, also known as matrix metalloproteinase 14, which is involved in the degradation of extracellular matrix components.
SYDE1 antibody
SYDE1 antibody was raised using a synthetic peptide corresponding to a region with amino acids PYLRPKRQPPLHLPLADPEVVTRPRGRGGPESPPSNRYAGDWSVCGRDFL
TBCB antibody
TBCB antibody was raised in rabbit using the N terminal of Tbcb as the immunogenDegré de pureté :Min. 95%HPGDS antibody
The HPGDS antibody is a highly specialized monoclonal antibody that targets the enzyme hematopoietic prostaglandin D synthase (HPGDS). HPGDS plays a crucial role in the synthesis of prostaglandin D2 (PGD2), which is involved in various physiological processes such as inflammation and allergic responses. This antibody specifically binds to HPGDS, inhibiting its activity and preventing the production of PGD2.C19ORF21 antibody
C19ORF21 antibody was raised using the C terminal Of C19Orf21 corresponding to a region with amino acids RRNALFPEVFSPTPDENSDQNSRSSSQASGITGSYSVSESPFFSPIHLHSCD5 antibody (Spectral Red)
CD5 antibody (Spectral Red) was raised in rat using CD5/Lyt-1 as the immunogen.LCK antibody
The LCK antibody is a powerful tool in the field of Life Sciences. It is a cytotoxic antibody that specifically targets and binds to LCK (lymphocyte-specific protein tyrosine kinase), an enzyme involved in T-cell signaling. This antibody can be used for various applications, including immunohistochemistry, flow cytometry, and Western blotting.APLP2 antibody
The APLP2 antibody is a highly specialized growth factor that plays a crucial role in protein kinase signaling pathways. This monoclonal antibody is designed to specifically target and bind to the APLP2 antigen, facilitating an antigen-antibody reaction that leads to neutralizing its activity. The APLP2 antibody has been extensively tested and proven effective in various life science applications, including research studies focused on understanding the role of APLP2 in disease progression and therapeutic interventions. Additionally, this antibody has shown promising results as an anti-MERTK antibody, blocking the activation of MERTK protein and interfering with interferon signaling pathways. With its high specificity and affinity for the target molecule, the APLP2 antibody is a valuable tool for researchers working in the field of immunology and molecular biology.RAB3IL1 antibody
RAB3IL1 antibody was raised using a synthetic peptide corresponding to a region with amino acids ARGKIDMLQAEVTALKTLVITSTPASPNRELHPQLLSPTKAGPRKGHSRHDDX1 antibody
DDX1 antibody was raised using a synthetic peptide corresponding to a region with amino acids ILGGGDVLMAAETGSGKTGAFSIPVIQIVYETLKDQQEGKKGKTTIKTGADAPP1 antibody
DAPP1 antibody was raised using the middle region of DAPP1 corresponding to a region with amino acids KHFANQPLIGSETGTLMVLKHPYPRKVEEPSIYESVRVHTAMQTGRTEDDEzrin antibody
The Ezrin antibody is a highly effective monoclonal antibody that specifically targets and neutralizes the activated form of Ezrin protein. This antibody has been extensively studied in various research fields, including Life Sciences and Antibodies. It has shown remarkable efficacy in inhibiting the interaction between Ezrin and its binding partners, such as fibrinogen, leading to the disruption of important cellular processes.CKMB Antibody
CKMB Antibody is a monoclonal antibody that specifically targets creatine kinase MB (CK-MB), an enzyme found in the heart muscle. This antibody is widely used in the field of Life Sciences for various applications, including research and diagnostic purposes. CKMB Antibody has high affinity and specificity towards CK-MB, making it an ideal tool for detecting and quantifying CK-MB levels in biological samples. It can be used in immunoassays such as ELISA or Western blotting to accurately measure CK-MB concentrations. Additionally, this antibody has been utilized in the development of ophthalmic formulations and has shown potential therapeutic applications in targeting chemokines and tumor necrosis factor-alpha (TNF-α). With its exceptional binding properties and versatility, CKMB Antibody plays a crucial role in advancing scientific understanding of biomolecules and their interactions, paving the way for innovative research breakthroughs in the field of Life Sciences.PRKAA1 antibody
PRKAA1 antibody was raised using the N terminal of PRKAA1 corresponding to a region with amino acids GELFDYICKNGRKSDVPGVVKTGSTKELDEKESRRLFQQILSGVDYCHRH
Degré de pureté :Min. 95%Thrombin antibody (HRP)
Thrombin antibody (HRP) was raised in sheep using Thrombin prepared from purified rabbit Prothrombin as the immunogen.CX36 antibody
CX36 antibody was raised using the middle region of Cx36 corresponding to a region with amino acids NTSKETEPDCLEVKELTPHPSGLRTASKSKLRRQEGISRFYIIQVVFRNALKB1 antibody
The LKB1 antibody is a monoclonal antibody that plays a crucial role in inhibiting the growth factor signaling pathway. It is water-soluble and specifically targets enteroendocrine cells, which are responsible for regulating glucose homeostasis and insulin secretion. This antibody has shown promising results in reducing amyloid plaque formation in Alzheimer's disease models, making it a potential therapeutic option for treating this neurodegenerative disorder. Additionally, the LKB1 antibody has cytotoxic effects on cancer cells by inhibiting endothelial cell growth and disrupting tumor angiogenesis. It can be used as a research tool in various life sciences studies, including investigating dopamine signaling pathways and assessing microvessel density. With its neutralizing properties, this mouse monoclonal antibody is highly valuable for both basic research and potential therapeutic applications.
RAD17 antibody
The RAD17 antibody is a highly specialized inhibitor used in Life Sciences research. It targets the RAD17 protein, which plays a crucial role in DNA repair and cell cycle regulation. This antibody is commonly used in assays to study the function of RAD17 and its interactions with other proteins involved in DNA damage response pathways. The RAD17 antibody is a polyclonal antibody, meaning it is produced by multiple clones of B cells and can recognize different epitopes on the target protein. Its high specificity makes it an ideal tool for studying the effects of RAD17 inhibition on various cellular processes. Researchers also use this antibody to investigate the potential therapeutic applications of targeting RAD17 in diseases such as cancer. With its exceptional binding affinity and selectivity, the RAD17 antibody offers valuable insights into the intricate mechanisms underlying DNA repair and genome stability.RP2 antibody
RP2 antibody was raised using a synthetic peptide corresponding to a region with amino acids LEFNGDGAVEVCQLIVNEIFNGTKMFVSESKETASGDVDSFYNFADIQMGFilaria Antibody
Filaria Antibody is a highly effective and specialized medication that targets specific antibodies, including anti-cd25 antibody drugs. It falls under the category of histone deacetylase inhibitors and is known for its potent amide and heteroaromatic properties. Developed for use in the field of Life Sciences, this monoclonal antibody has been extensively tested and proven to be highly activated against filaria infections.STAU1 antibody
STAU1 antibody was raised using a synthetic peptide corresponding to a region with amino acids PSTTSSLPSENAGRPIQNSALPSASITSTSAAAESITPTVELNALCMKLG
TTF1 antibody
The TTF1 antibody is a highly specialized polyclonal antibody used in Life Sciences research. It is designed to target and bind to the thyroid transcription factor 1 (TTF1), which plays a crucial role in regulating the expression of genes involved in cholinergic signaling and glycan synthesis. This antibody can be used for various applications, including immunohistochemistry, Western blotting, and ELISA assays.PYCR2 antibody
PYCR2 antibody was raised using the middle region of PYCR2 corresponding to a region with amino acids LDSEQHPCQLKDNVCSPGGATIHALHFLESGGFRSLLINAVEASCIRTRECOL1A2 antibody
The COL1A2 antibody is a powerful tool used in Life Sciences research. It specifically targets collagen, a crucial component of connective tissues, and can be used to investigate various cellular processes. This antibody has been shown to neutralize the effects of dopamine, TGF-beta1, and interferon, making it an essential tool for studying their roles in different biological systems. Additionally, the COL1A2 antibody has been used to successfully detect and measure the levels of activated polymerase enzyme and TGF-beta growth factor in samples. It is available as a polyclonal antibody and has also been used in studies involving phosphatase and glutamate. With its high specificity and reliability, the COL1A2 antibody is an invaluable asset for researchers aiming to unravel the intricacies of collagen-related processes.GALM antibody
GALM antibody was raised using a synthetic peptide corresponding to a region with amino acids SKEKHFCARVHHAASGRVLEVYTTQPGVQFYTGNFLDGTLKGKNGAVYPKOSBPL1A antibody
OSBPL1A antibody was raised using the middle region of OSBPL1A corresponding to a region with amino acids EGEHLGSRKHRMSEEKDCGGGDALSNGIKKHRTSLPSPMFSRNDFSIWSIInvolucrin antibody
The Involucrin antibody is a highly specialized monoclonal antibody that targets the biomolecule involucrin. It is commonly used in Life Sciences research to study the role of involucrin in various biological processes. Involucrin is a glycoprotein that plays a crucial role in the formation and maintenance of the skin barrier. This antibody specifically binds to involucrin, allowing researchers to study its function and localization within cells.LYPD5 antibody
LYPD5 antibody was raised using the N terminal of LYPD5 corresponding to a region with amino acids WTGPPAGQTQSNADALPPDYSVVRGCTTDKCNAHLMTHDALPNLSQAPDPp27 Kip1 antibody
The p27 Kip1 antibody is a highly specialized antibody that is used in various research applications in the field of Life Sciences. It is an autoantibody that specifically targets the p27 Kip1 protein, which plays a crucial role in regulating cell cycle progression and cell proliferation. This antibody is colloidal in nature, allowing for easy and efficient detection of the p27 Kip1 protein in biological samples.RORA antibody
RORA antibody was raised using the N terminal of RORA corresponding to a region with amino acids CGDKSSGIHYGVITCEGCKGFFRRSQQSNATYSCPRQKNCLIDRTSRNRCThioredoxin 1 antibody
Thioredoxin 1 antibody is a polyclonal antibody that is used in life sciences research. It is specifically designed to target and bind to thioredoxin 1, which is an enzyme involved in redox regulation. This antibody can be used for various applications, including immunohistochemistry, Western blotting, and ELISA. By detecting the presence of thioredoxin 1, researchers can gain insights into its role in cellular processes such as protein folding, DNA repair, and cell signaling. Whether you're studying atypical hemolytic extracts or investigating glucose transporter activation, this high-quality thioredoxin 1 antibody will provide accurate and reliable results. Choose from our range of monoclonal or polyclonal antibodies to suit your specific research needs. With our antibodies, you can trust that your experiments will yield precise and reproducible data in the field of life sciences.HBsAg antibody (HRP)
HBsAg antibody (HRP) was raised in goat using subtypes ad & ay as the immunogen.KCNAB1 antibody
KCNAB1 antibody was raised using the C terminal of KCNAB1 corresponding to a region with amino acids VPESSRASLKCYQWLKERIVSEEGRKQQNKLKDLSPIAERLGCTLPQLAVDHODH antibody
DHODH antibody was raised using the N terminal of DHODH corresponding to a region with amino acids FGFVEIGSVTPKPQEGNPRPRVFRLPEDQAVINRYGFNSHGLSVVEHRLRRSK1 antibody
The RSK1 antibody is a polyclonal antibody that is used in life sciences research. It specifically targets the oncogenic kinase RSK1, which is involved in various cellular processes. This antibody can be used to detect and study the expression and activation of RSK1 in different cell types and tissues. It has been shown to react with multiple protein isoforms of RSK1 and can be used for applications such as immunohistochemistry, western blotting, and flow cytometry. The RSK1 antibody is a valuable tool for researchers studying the role of RSK1 in cancer development, signaling pathways, and other biological processes. Additionally, this antibody can be used in diagnostic applications to detect autoantibodies against RSK1 or as a therapeutic agent targeting RSK1 activity.RAB37 antibody
RAB37 antibody was raised in rabbit using the middle region of RAB37 as the immunogen
Degré de pureté :Min. 95%NMNAT1 antibody
The NMNAT1 antibody is a highly specific monoclonal antibody that targets the glial fibrillary acidic protein (GFAP). It can be used in various research applications such as immunohistochemistry, western blotting, and ELISA. This antibody has been shown to have high affinity and specificity for GFAP, making it an excellent tool for studying the expression and localization of this protein in different tissues and cell types. Additionally, the NMNAT1 antibody has been used in studies investigating the role of GFAP in diseases such as Alzheimer's disease, Parkinson's disease, and multiple sclerosis. Its ability to specifically bind to GFAP makes it a valuable tool for researchers studying the function and regulation of this important protein.PARVB antibody
The PARVB antibody is a potent mitogen that plays a crucial role in various biological processes. It is a monoclonal antibody specifically designed to target PARVB, a protein that belongs to the glutamate and EGF-like domain-containing protein family. This antibody has been extensively studied in Life Sciences research and has shown promising results.RBM4B antibody
RBM4B antibody was raised using the C terminal of RBM4B corresponding to a region with amino acids AAAATTSSYYGRDRSPLRRAAAMLPTVGEGYGYGPESELSQASAATRNSLMSI2 antibody
MSI2 antibody was raised using a synthetic peptide corresponding to a region with amino acids EANGSQGTSGSANDSQHDPGKMFIGGLSWQTSPDSLRDYFSKFGEIRECMcSRC antibody
The cSRC antibody is a highly specialized biomarker used in life sciences research. It is a polyclonal antibody that specifically targets the reductase enzyme, which plays a crucial role in various cellular processes. This antibody has been extensively studied and validated for its high specificity and sensitivity. It has been shown to effectively detect and quantify the expression levels of reductase in different cell types.FAM82B antibody
FAM82B antibody was raised using the N terminal of FAM82B corresponding to a region with amino acids MALAARLWRLLPFRRGAAPGSRLPAGTSGSRGHCGPCRFRGFEVMGNPGTPTPRS antibody
The PTPRS antibody is an acidic phosphatase that plays a crucial role in various cellular processes. It is involved in the regulation of β-catenin and nuclear factor kappa-light-chain-enhancer (NF-κB) signaling pathways, which are important for cell growth and survival. This antibody is commonly used in life sciences research to study protein activation and signaling cascades. It has been shown to be effective in detecting activated proteins, such as caspase-9, and can be used to study cytotoxic effects in different cell types. Additionally, the PTPRS antibody has polymerase activity and can be utilized in assays involving p38 mitogen-activated protein (MAP) kinase or other MAP kinase pathways. Its high specificity and sensitivity make it a valuable tool for researchers studying cellular processes and protein interactions.CAMK1D antibody
CAMK1D antibody was raised using the middle region of CAMK1D corresponding to a region with amino acids KNIHESVSAQIRKNFAKSKWRQAFNATAVVRHMRKLHLGSSLDSSNASVSTRAPPC1 antibody
TRAPPC1 antibody was raised using the middle region of TRAPPC1 corresponding to a region with amino acids YKLMYGMLFSIRSFVSKMSPLDMKDGFLAFQTSRYKLHYYETPTGIKVVMPR3 antibody
PR3 antibody is a specific antibody that targets the proteinase 3 (PR3) enzyme. PR3 is a collagen-degrading enzyme found in neutrophils and plays a role in various physiological processes. The PR3 antibody can be used for research purposes in the field of Life Sciences, such as studying the interaction between PR3 and other molecules or investigating its role in diseases. This monoclonal antibody has been shown to bind specifically to PR3 and can be used in techniques like immunohistochemistry or Western blotting to detect the presence of PR3 in samples. The use of this antibody provides researchers with a valuable tool for understanding the function and regulation of PR3 in different biological contexts.Complement C9 antibody
Complement C9 antibody is a monoclonal antibody that specifically targets and binds to the complement protein C9. This antibody has been extensively studied for its cytotoxic effects on cells expressing high levels of C9. It has also been used in various research techniques such as electrochemical impedance spectroscopy, transcription-polymerase chain reaction, and antigen-antibody reactions. Complement C9 antibody can be used in combination with other antibodies or therapeutic agents to enhance its cytotoxicity or modulate immune responses. This antibody is widely used in the field of immunology and biomedical research, particularly in studies related to colony-stimulating factors, adeno-associated viral vectors, decitabine treatment, and blood plasma analysis. With its high specificity and potency, Complement C9 antibody is an invaluable tool for researchers investigating the role of complement proteins in various biological processes.
FGFR1 antibody
The FGFR1 antibody is a powerful tool used in immunoassays to detect and quantify the presence of FGFR1 protein. This monoclonal antibody specifically binds to FGFR1, allowing for accurate measurements in various research applications.GRP94 antibody
The GRP94 antibody is a highly specialized monoclonal antibody that is used in the field of Life Sciences. It is primarily used for research purposes and has a wide range of applications. This antibody specifically targets and binds to GRP94, which is a member of the heat shock protein 90 (HSP90) family.
