Anticorps primaires
Sous-catégories appartenant à la catégorie "Anticorps primaires"
- Anticorps pour la recherche sur le cancer(3.721 produits)
- Anticorps cardio-vasculaires(2 produits)
- Biologie du développement(764 produits)
- Anticorps relatifs à l’épigénétique(162 produits)
- Anticorps d'immunologie(2.585 produits)
- Anticorps du métabolisme(286 produits)
- Anticorps de microbiologie(741 produits)
- Transduction du signal(2.765 produits)
- Tags & Marqueurs cellulaires(34 produits)
75594 produits trouvés pour "Anticorps primaires"
MXRA5 antibody
The MXRA5 antibody is a highly effective monoclonal antibody used in the field of Life Sciences. This antibody has the unique ability to neutralize colloidal and reactive carbamazepine, making it an essential tool for researchers studying the effects of this drug on various biological processes. Additionally, the MXRA5 antibody has been shown to have a high affinity for mesenchymal stem cells, making it an ideal choice for studies involving these cells. With its ultrasensitive detection capabilities, this antibody can accurately measure protein carbonyls and fibrinogen levels, providing valuable insights into oxidative stress and blood clotting mechanisms. Whether you're conducting research or developing diagnostic assays, the MXRA5 antibody is a reliable and versatile tool that will help you achieve accurate and meaningful results.
PHB2 antibody
The PHB2 antibody is a highly specialized antibody used in the field of Life Sciences. It targets specific proteins and molecules involved in various biological processes. This antibody has been shown to interact with interferon, β-catenin, collagen, and growth factors. It acts as a cox-2 inhibitor and has the ability to bind to nuclear β-catenin.WIPI1 antibody
WIPI1 antibody was raised using the middle region of WIPI1 corresponding to a region with amino acids LLGSGTTEENKENDLRPSLPQSYAATVARPSASSASTVPGYSEDGGALRGFLJ20433 antibody
FLJ20433 antibody was raised using the N terminal of FLJ20433 corresponding to a region with amino acids MGPAGCAFTLLLLLGISVCGQPVYSSRVVGGQDAAAGRWPWQVSLHFDHN
ORC2 Antibody
The ORC2 Antibody is a highly effective cation-neutralizing antibody that is widely used in the field of Life Sciences. It is specifically designed to inhibit the activity of extracellular histones and other growth factors, making it an essential tool for researchers studying cell signaling pathways and protein interactions. This antibody has been extensively tested and proven to be highly specific and sensitive, ensuring accurate and reliable results in various experimental settings. With its exceptional performance, the ORC2 Antibody is a valuable asset for any laboratory or research facility.GANP antibody
The GANP antibody is a highly versatile and effective tool in the field of Life Sciences. It is available in both polyclonal and monoclonal forms, providing researchers with options to suit their specific needs. This antibody has been shown to have neutralizing properties against polymorphic antigens, making it an excellent choice for studies involving intraocular antigen-antibody reactions.CD33 Antibody
CD33 Antibody is a monoclonal antibody that specifically targets CD33, a cell surface protein expressed on myeloid cells. This antibody can be used in various applications in the field of Life Sciences. CD33 Antibody has been widely used as a cytotoxic conjugate in cancer research and therapy. It can be conjugated with cytotoxic agents to selectively deliver them to CD33-expressing cells, leading to their destruction.PER3 antibody
The PER3 antibody is a highly specialized product used in the field of Life Sciences. It is a polyclonal antibody that specifically targets and neutralizes the glycan glycopeptide alpha-fetoprotein. This antibody has been extensively studied and has shown promising results in inhibiting the production of IFN-gamma, a chemokine involved in inflammatory responses. Additionally, the PER3 antibody exhibits neuroprotective properties and acts as an inhibitory factor against certain glycosylation processes. With its high specificity and effectiveness, this monoclonal antibody is a valuable tool for researchers in various fields of study, including immunology, molecular biology, and cell biology.TUBB3 antibody
The TUBB3 antibody is a highly specialized product in the field of Life Sciences. It is an antibody that specifically binds to the TUBB3 receptor, which plays a crucial role in various cellular processes. This antibody is produced using advanced techniques and has been extensively tested for its specificity and functionality.OTUB1 antibody
The OTUB1 antibody is a polyclonal antibody that targets the protein OTUB1, which is involved in various cellular processes such as collagen synthesis. This antibody can be used in life sciences research to study the function and regulation of OTUB1. It has been shown to have neutralizing activity against vasoactive intestinal peptide (VIP), a peptide involved in vasodilation and immune modulation. Additionally, this antibody has been used in studies involving ketamine, interferon, epidermal growth factor, and ornithine. Whether you need a monoclonal or polyclonal antibody, the OTUB1 antibody is a valuable tool for immunoassays and other experimental techniques.AGT antibody
AGT antibody was raised in Mouse using a purified recombinant fragment of human AGT expressed in E. coli as the immunogen.Lp-PLA2 antibody
The Lp-PLA2 antibody is a cytotoxic antibody that targets choline acetyltransferase, an enzyme involved in the synthesis of acetylcholine. It has been shown to inhibit the growth of cancer cells by blocking the activity of cholinergic signaling pathways. This monoclonal antibody specifically binds to the epidermal growth factor receptor (EGFR) and inhibits its activation, leading to decreased cell proliferation and increased apoptosis. The Lp-PLA2 antibody has also been found to have anti-androgenic effects, making it a potential therapeutic option for hormone-dependent cancers. Additionally, this antibody has shown promising results in reducing thrombocytopenia, a condition characterized by low platelet count.
IL2 antibody (Mouse)
IL2 antibody (Mouse) was raised in Mouse using a purified recombinant fragment of IL2 expressed in E. coli as the immunogen.Vimentin antibody
Vimentin antibody was raised in Mouse using a purified recombinant fragment of Vimentin(aa2-466) expressed in E. coli as the immunogen.CD45 antibody
CD45 antibody was raised in Mouse using a purified recombinant fragment of CD45 expressed in E. coli as the immunogen.GSK3B antibody
GSK3B antibody was raised in Mouse using a purified recombinant fragment of human GSK3B expressed in E. coli as the immunogen.Myc antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the category of rifamycins. It is highly effective in treating tuberculosis infections due to its bactericidal activity. This compound works by inhibiting bacterial growth through the binding to DNA-dependent RNA polymerase, preventing transcription and replication. Its high frequency of human activity has been demonstrated using a patch-clamp technique on human erythrocytes. The active form of this drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Moreover, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits cell growth in culture.Troponin I antibody
Troponin I antibody is a highly specific monoclonal antibody that is commonly used in the field of Life Sciences. It is activated by isothiocyanate and has shown great efficacy in detecting troponin I, a protein found in cardiac muscle cells. This antibody binds to troponin I and can be used for various applications, including research, diagnostic tests, and therapeutic treatments. Additionally, it has been shown to have inhibitory effects on steroid synthesis and dopamine release. The monoclonal nature of this antibody ensures high specificity and sensitivity, making it a valuable tool in the study of cardiac function and related disorders.
Integrin β antibody
Integrin beta antibody is a powerful tool used in Life Sciences research. It is a monoclonal antibody that specifically binds to integrin beta, a receptor involved in cell adhesion and signaling. This antibody can be used to study various cellular processes, including cell migration, proliferation, and differentiation. Integrin beta antibody has been widely used in studies related to cancer research, autoimmune diseases, and inflammation. Its high specificity and affinity make it an ideal choice for researchers looking to investigate the role of integrin beta in different biological systems. Whether you are studying growth factors, chemokines, or collagen interactions, this antibody will provide valuable insights into cellular mechanisms. With its precise targeting ability and disulfide bond formation inhibition properties, Integrin beta antibody is a crucial component in understanding complex molecular pathways. Trust this reliable tool for your research needs and unlock new discoveries in the field of Life Sciences.Mammaglobin 1 antibody
Mammaglobin 1 antibody was raised in Mouse using a purified recombinant fragment of SCGB2A2(aa1-193) expressed in E. coli as the immunogen.CDC2 antibody
The CDC2 antibody is a highly specialized antibody used in Life Sciences research. It is specifically designed to target and bind to the CDC2 protein, which plays a crucial role in cell division and regulation. This antibody is widely used in studies involving mesenchymal stem cells and their activation, as well as in the detection of autoantibodies and amyloid plaque formation.PGM2 antibody
The PGM2 antibody is a highly specialized antibody used in Life Sciences for various applications. It is a polyclonal antibody that specifically targets PGM2, a glycoprotein involved in transfer reactions. This antibody is commonly used in immunoassays and other research techniques to detect and quantify PGM2 levels in biological samples.CD166 antibody
CD166 antibody was raised in Mouse using a purified recombinant fragment of CD166(aa405-524) expressed in E. coli as the immunogen.IPP antibody
IPP antibody was raised using the C terminal of IPP corresponding to a region with amino acids EMQGLIYVIGGISNEGIELRSFEVYDPLSKRWSPLPPMGTRRAYLGVAALTroponin T Type 3 antibody
Troponin T Type 3 antibody was raised using a synthetic peptide corresponding to a region with amino acids PRPKLTAPKIPEGEKVDFDDIQKKRQNKDLMELQALIDSHFEARKKEEEEWDR49 antibody
WDR49 antibody was raised using the N terminal of WDR49 corresponding to a region with amino acids SQDFRCLFHFDEAHGRLFISFNNQLALLAMKSEASKRVKSHEKAVTCVLYFAK antibody
FAK antibody was raised in Mouse using a purified recombinant fragment of human FAK expressed in E. coli as the immunogen.AP2M1 antibody
The AP2M1 antibody is a highly specialized antibody used in Life Sciences research. It is primarily used to detect androgen receptors in blood plasma, making it an invaluable tool for studying hormone-related processes. This cytotoxic antibody specifically targets actin filaments within cells, allowing researchers to visualize and study the dynamics of actin in various cellular processes. Additionally, the AP2M1 antibody can be used to investigate the role of nuclear antigens and extracellular proteins involved in cell signaling pathways. Its high specificity and sensitivity make it a valuable tool for researchers studying microvessel density and other related areas of research. Whether you need a monoclonal or polyclonal antibody, the AP2M1 antibody is an excellent choice for your research needs.Akt antibody
Akt, or Protein Kinase B (PKB), is a kinase crucial for cell growth, survival, metabolism, and proliferation within the PI3K/Akt/mTOR pathway, which responds to external signals like growth factors. Activated through phosphorylation at specific sites, Akt influences key cellular processes by promoting cell survival, aiding protein synthesis through mTOR activation, regulating glucose metabolism, and supporting blood vessel formation and cell movement. Its hyperactivation is common in cancers, making it a target for cancer therapies, while its role in glucose regulation links it to insulin resistance and type 2 diabetes.CACNB2 antibody
CACNB2 antibody was raised using the middle region of CACNB2 corresponding to a region with amino acids HLADYLEAYWKATHPPSSSLPNPLLSRTLATSSLPLSPTLASNSQGSQGDAKR7A3 antibody
AKR7A3 antibody was raised using a synthetic peptide corresponding to a region with amino acids VETELFPCLRHFGLRFYAFNPLAGGLLTGKYKYEDKNGKQPVGRFFGNTWAATF antibody
The AATF antibody is a glycosylated antibody that plays a crucial role in endothelial growth and development. It is commonly used in Life Sciences research to study the effects of various factors on cell growth and apoptosis. This antibody has been shown to interact with erythropoietin, human serum albumin, and other proteins involved in cell signaling pathways. Additionally, it has been found to bind to nuclear proteins and amyloid plaque, suggesting its potential involvement in neurodegenerative diseases. The AATF antibody is also used in studies related to androgen signaling and can be a valuable tool for researchers studying these areas of interest. With its high specificity and affinity for its target molecules, this polyclonal antibody offers reliable results for various applications.MKK6 antibody
The MKK6 antibody is a monoclonal antibody that is used in Life Sciences research. It specifically targets and binds to MKK6, a protein involved in various cellular processes such as endothelial growth and the production of growth factors. This antibody has been shown to inhibit the activity of MKK6, making it a valuable tool for studying its function and potential therapeutic applications.PGM1 antibody
PGM1 antibody was raised using the middle region of PGM1 corresponding to a region with amino acids ATIRLYIDSYEKDVAKINQDPQVMLAPLISIALKVSQLQERTGRTAPTVIOLR1 antibody
The OLR1 antibody is a highly specialized antibody used in the field of Life Sciences. It is designed to target and neutralize collagen autoantibodies, as well as TNF-α (tumor necrosis factor-alpha). This specific antibody has a unique structure with EGF-like domains that allow it to bind to activated fibronectin and epidermal growth factor. Additionally, it has been shown to have a high affinity for TGF-beta and various chemokines. The OLR1 antibody is an essential tool for researchers studying the role of these molecules in different biological processes. With its specificity and effectiveness, this polyclonal antibody is a valuable asset in scientific studies and experiments.NXF3 antibody
NXF3 antibody was raised using the C terminal of NXF3 corresponding to a region with amino acids SSFLVDMWYQTEWMLCFSVNGVFKEVEGQSQGSVLAFTRTFIATPGSSSS
Clostridium botulinum A Toxoid antibody
Affinity purified Chicken Polyclonal Clostridium Botulinum A Toxoid antibody, Anti-Clostridium Botulinum A Toxoid antibodyE2A antibody
The E2A antibody is a high polymer monoclonal antibody that exhibits excellent pharmacokinetic properties. It is derived from human proteins and contains acid residues and disulfide bonds, ensuring its stability and effectiveness. This antibody specifically targets growth factors and can be used in various immunoassays and research applications.RCC2 antibody
The RCC2 antibody is a polyclonal antibody that specifically targets the protein RCC2. It is commonly used in research and life sciences to study various cellular processes and functions. RCC2 plays a crucial role in cell division, as it regulates the assembly and disassembly of the mitotic spindle during mitosis. This antibody can be used to detect RCC2 levels in different tissues and cells, providing valuable insights into its function and potential therapeutic applications.GM2A antibody
The GM2A antibody is a polyclonal antibody that has various applications in the field of Life Sciences. It can be used to detect and measure the levels of creatine kinase and phosphatase, which are important enzymes involved in cellular metabolism. Additionally, this antibody can be used for research involving mesenchymal stem cells, as it can help identify and characterize these cells. The GM2A antibody can also be used in electrode-based assays to study glucose-6-phosphate metabolism and collagen synthesis. In the medical field, this antibody has potential applications in diagnostics and therapeutics, particularly in the detection and treatment of diseases such as cancer. It has been shown to have binding affinity towards sorafenib, a drug used in the treatment of liver cancer. Furthermore, the GM2A antibody can be utilized to measure hepatocyte growth factor levels in human serum samples. Overall, this versatile antibody offers researchers and clinicians a valuable tool for studying various biological processes and developing innovative treatments.
CEACAM6 antibody
CEACAM6 antibody was raised using a synthetic peptide corresponding to a region with amino acids EIQNPASANRSDPVTLNVLYGPDGPTISPSKANYRPGENLNLSCHAASNPMERTK Antibody
The MERTK Antibody is a highly specialized monoclonal antibody that targets the MERTK protein. This activated anti-MERTK antibody has been extensively researched and developed in the field of Life Sciences. It is specifically designed to neutralize the activity of MERTK, an important receptor tyrosine kinase involved in various cellular processes.
LZTS2 antibody
LZTS2 antibody was raised using the N terminal of LZTS2 corresponding to a region with amino acids EPLCPAVPPRKAVPVTSFTYINEDFRTESPPSPSSDVEDAREQRAHNAHLDegré de pureté :Min. 95%
